SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|448244026|ref|YP_007408079.1| from Serratia marcescens WW4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|448244026|ref|YP_007408079.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.95e-109
Family FMN-linked oxidoreductases 0.00000000044
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.42e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000533
Further Details:      
 
Domain Number 3 Region: 461-528,567-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.42e-23
Family C-terminal domain of adrenodoxin reductase-like 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|448244026|ref|YP_007408079.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase, NADH and FMN-linked [Serratia marcescens WW4]
Sequence
MSNYPHLLAPLDLGFTTLKNRVLMGSMHTGLEELPDGPQRLAAFYAERAAAGVALIVTGG
IAPNEQGVVFRGGSLLNSEAQLPHHRPVTEAVHRAGGKIALQILHTGRYSYQPKLVAPSA
LQAPINPFTPSALSEAEIEQTIADFARCAALAQQAGYDGVEVMGSEGYLINQFLTTRTNQ
RDDQWGGSFTNRMRFAVETVRAVRQAVGPEFILIYRLSMLDLVEDGSSWQEIEQLALAIE
QAGATIINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVSIPLITTNRINDPAVAEQV
LADGCADMVSMARPFLADAAFVQKAAEGRADEINTCIGCNQACLDQIFEGKLTSCLVNPR
ACRETEMPLTMAEKPKKLAVVGAGPAGLAFATTAASRGHQVTLFDAAEQIGGQFNIAKQI
PGKEEFHETLRYFRRQLALREVTVRLGVKVEAADLSEFDEVILACGIVPRTPDIPGIGHA
KVLSYLDVLRDKKPVGQRVAIVGAGGIGFDTAEYLSQHGVSSSLDQAEFNREWGIDGRLE
QRGGLAAQGPQAPRAARQIYLLQRKTSKVGEGLGKTTGWIHRASLAMRGVKMLNSVSYRL
IDDEGLHITRAEQDSCLPVDTVVICAGQEPRRELQQPLLAMGKTVHLIGGADVAAELDAR
RAIDQGTRLAMAL
Download sequence
Identical sequences WP_015379147.1.69387 gi|448244026|ref|YP_007408079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]