SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_114600 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_114600
Domain Number 1 Region: 1005-1052
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PCAS_114600
Sequence length 1175
Comment PCAS_114600 CIR protein 11524259:11528029 forward MW:120442
Sequence
MSSKLCKLLLDVDEYFNNGIVDEGKFDKNKSLQSKCPQKGQENKCTTNYERINALGEYLY
QKMPKNSNEFKGEGINNNLDIEFFMMWLGDKIYKVDKDYKSTLEESYEKHLKNITGKFEY
WDALNSKQVYKNATIVRMHIFYNLLNSICKTINELDKNLNNTDAAILKKYGTHCLDLYRN
IYESVKGCKSYTHLLDSLKTIYEYIKSYKITGNTSLDDSKKVLLFVSTPSLTTSDHKNEY
FIHNYETLNFGDEGCEKLKLKDEKDGEKGSLPDLQSIQGDKLPKNPKGGNRSKIQLSAEL
RQKLEAQKELLRKARQKHQSRPRPGIPNPAATKPPTGPKPQPPPASSSPQHTQKIPGQSI
NLKPSSGQSTSTQTDPAKPAPAKPVPPPQPSPPSSGSSQKDTKLKGSQTPGKTHQDEAGG
TVNGAGSVTKGGKGIPGDGAGSGTVSGTGGGNRGLGGGAGGGIGGGIGGKDNAKLGSNND
AGVKSSGSSGGAGVSVSGQGATDSVIGSKSGGKGGAGINKGDPGGNKVNTHSGKGGNGPG
GVGGSGPIKTQGDQGGSSGGSGSSDKVQGKLNGGTTDTSANQKGTGSGQVGTVDASGGGA
GGVISNGQGSQVNTGGAQGDQGKSPGGLGGSSSVQGATKSVAGGPGVGAGTPISGPGDGK
GTGVNGPGGAGVGQGDTGSVTGGIGGGSVSQVGGTGGGPGGVKINQGNPGTNHGGSGTNQ
GGSPGDGANGGQGSSGSQTTTGGGTVNTGNNTGDSGSGKVGGSGGGAGVGQGIQNPVSGS
TGSPGGRDPAHSSGSSYGSWSNLWGINLNPMSYIPSISDMYKSQKNILTNAYNQASSVYN
STAAIVKNTYDSTVTFAKDTYDSTVTFVKDTYDNTVTFVKDTYTASSNYITDAVNNVTTQ
FNSFGTSSQSGGNQSGSNTPGSGANTYNPPHPNLSPPLPSSPTLPLPQTNQTPSSSTSQS
TSPPLSLLPSQTSQPILPLQAPSVTHSPSSQQQPSSTQVSPGTIQQSTSTTGKGVSQTVA
STKAPLSSSGINPSSIGNGNKTPGTSIQVSEKPSIWCIGPNKKCDLVGISVIGVSISIFL
AIMYKYLSFGSAKNLKKEKNMKRVINSTSGKRQIQIIINSSTKKKQTKKSIKPVYRGKPP
LLNIYKLMQADPMPFINLFFLLIFFVYKRKRDTIE
Download sequence
Identical sequences A0A077TQU6
XP_016654121.1.12432 PCAS_114600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]