SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_061600 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_061600
Domain Number 1 Region: 67-394,445-518
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.78e-85
Family Cystathionine synthase-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PCAS_061600
Sequence length 532
Comment PCAS_061600 cysteine desulfurase, putative 4035623:4037327 forward MW:61859
Sequence
MNDKSICAILLLLVKIAGYYSYYISPLKKNICTPHTYKGHRLKLQNEKPEIDNNIINYFK
NIRSDYPFFQQNNSPIYFDNAATTHKPKSVIEKIKNFYSYNNSNIHRGIYKISRNATDNY
EQVRNIVQKYINCDSPDEIIFTSGATYGINLVCSIVMDKIIKNENDEIYISYLEHNSNVV
PWQENIRKTKKGKLKYIPLKKNGYINIKKFVEKINDNTKIVSINHVSNVLGNIQNINLII
KKIKKKNPNIIVIIDAAQSFPHLKYDIKKMKLKNEDPDILVASGHKFCAPFGSGFVYIKK
KLTHASKTNPFLYGSNIITDVNKYRSKFVSSPHIFETGTQNISAILAMGEAIKYLEKIND
EGNAYKYEMYLYDLFLFYLRNFFTDHLIQMPYMPKQNSLTKPDEISTSTQVRSDKIDDKY
FPSEIQNEDNDYPNIYVHNTRKDNKKKIAILPLWSPNFTAFDLVTFLDFKNICIRSGHHC
ASLLHSKLFNINDSSRISMMFYNTPEEVRYLAEQISDTARMLHKMRKNGKAV
Download sequence
Identical sequences A0A077TIU8
XP_735720.2.12432 PCAS_061600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]