SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_100430 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_100430
Domain Number 1 Region: 513-735,779-895
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.81e-67
Family Ornithine decarboxylase major domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1223-1270,1329-1426
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 7.72e-16
Family Ornithine decarboxylase C-terminal domain 0.0081
Further Details:      
 
Weak hits

Sequence:  PCAS_100430
Domain Number - Region: 106-169
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 0.012
Family RNA-binding protein She2p 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PCAS_100430
Sequence length 2186
Comment PCAS_100430 lysine decarboxylase, putative 8429709:8436269 reverse MW:251915
Sequence
MDFPNNAKLGGEDNTMYGNNMFENRNIENDHMNTNNSTMNVDTESGVCLDKEGKNPFYTF
PCNLKQNKSVILKRMRRKNKYENIDLLEKYININNATNVCSLRIKLWEALMLYVNKINVE
LIYFIINCLEEIEVYWGEEAKNALQEIISLINDKKYKEVSNKIGDILSSLSVTSGKVNDD
SPFFYTLIVSGKREEYHNNNLNINNNNINMNTNNNYNSNNNNGNYFNSDLSCELNKFLQY
EQNRFSNQNNNKKLEYKIVEVNNAKEALIACLINPQILSVVLVDNLIIDDETKNDSNNNN
IFFNFNENNSLNKNYIMNYNMPNNFKAKQNMCYNNVTNNGALSCGASNNDHTKTSEKKSR
NSRDGINSNDDETTSNNCNNRDENRSYDRSSNSSRWNSARNNTTNAGDKNLTRNRIFLKN
DYKFDIGDFVLGYDQLVSAPLEKMKKGYNSLVILIKSIAYIRSSVDIFCVCTSITLDKLR
SVNNKIIRIFTTHDDHSDLHESILDGVKKKIKTPFFNALKLYAERPIGVFHALAISKGNS
VRRSRWIQSLLDFYGVNLFKAESSATCGGLDSLLDPHGSLKEAQIMAARAYGSKYCFFVT
NGTSSSNKIVMQALVKPGDIILVDRACHKSHHYGFVLCQALPCYLDPYPVSRYGIYGAIP
IYVIKKTLLEYRNSNKLHLVKLIILTNCTFDGIVYNVKRVIEECLAIKPDLIFLFDEAWF
AYACFHPILKFRTAMTVAEKMRSKEQKKLYYKIHNRLLKKFGNVKSLNDVPSDTLLKTRL
YPNPAEYKVRVYATQSIHKSLTSLRQGSVILISDDNFESDAYTPFKEAYYTHMSTSPNYQ
ILATLDAGRAQMELEGYGLVEKQVEAAFLIRRELSEDPMISRYFRILNEDDLIPDSLRQC
CIAYMNAGNTNRRNGKKKHYHRKKTKKDEKNIDQEKESDNDRKQHDEINTQKQFFMDHDS
YSSRYNSPTASYSCISSKHAKGGMSEPFGNMKCNAHSNNSNNIPSSECINQGHMGNTYMK
NKLGNNAYPSNDLPSNGIIANRNNGENETNNLKKFNDKNDKRNINGEDTINCTSNFEDEQ
YSDRKMRNEAEKKCYEDKTTNKKSINKKNENYKDINSITNDSSSNFDENDVKCVCEDCIK
NENIDKVNEETRSRSCDSESSDDCDESDIYDKDKLCSKSNSINNFLEYFECSWLSEDEFV
LDPTRITLFTGYSGIDGDTFKVKWLMDKYGIQINKTSINSVLFQTNIGTTGSSCLFLKSC
LSLISQELDQKKALFNERDLNQFNESVYKLVYNYIELSQFSDFHPLFKKKYRNGNDKDNN
IFNREGDLRKAFYLAYEEDYVEYILMADLKERVKHNGMVVSASFIIPYPPGFPVLVPGQI
ISNEILNYLSGLSVKEIHGYDENIGFRCFYNFILNYFDNVIISDPYGYYQKIDKKLYDKL
KHESLRQEKQKNIENSYYIYVYDNKQNRMKKLYLYNGNTNSSEKSIIADNFMDDEGTSYS
IVCSDANNGTPFINNNTFSLINSNNMRKDTKADSKNINNSSASEIHYRDNDEDVHRDNKN
LNIIPPNYISMKNKMNNEESFCKTGFNLNVEKNYDEKNIDSINFTKTLGNDESSTKNNVH
KIHSASEKKKAYGHVLKKNSNKKYVLKGKEMKRHCVSNEKKNNKYNTLLTKMKNNGSEIP
KNEMCLNNNSFTNMQNQDFDHKTNRLIRENYFHDNTYKKSEQDNNNFDSLVNMKREDHYS
INADNNNGNDYHNNIMSGNIMNNIETASTHYNKTNISNNEEGNHIKSGFVNAQKFSKNIK
CCINNRHSSCVTNESKEYFNKMNEYMQGNHQNTNSLLDMHYMKTFSKFNKSDDGKYQKKS
NSYCLNKKMNTSNIIMDRKITKNDLLTEYRNGLNGKDEKLNNDMALNNFVRRNEREKINY
SDCSNSSKRLNKTTYTKSDGGNIQREMNNATNGNSYGSNNKLLNINNNCFNRNEENYNND
NEKENYDVVSTNCVTKGMQEMNEGNINGSNYSNCDCTNNEETENNRNCNNIKCGQNNNRN
QSNTLCCKQEDGECKNVDGDSNIGHINISNVQVKNEIKFCVNNFHLNENDVQVNSIIVEK
DNDKNSNRKLNTLNNNSYINNLITNVDDDTFIHKEGNFFLECALTNSEINCSSFDMDVSL
NNAYANEGSNDIKECRNYEGDKKNNF
Download sequence
Identical sequences A0A077YDD1
PCAS_100430 XP_740484.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]