SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_102780 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_102780
Domain Number 1 Region: 163-557
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.19e-80
Family GABA-aminotransferase-like 0.0000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PCAS_102780
Sequence length 569
Comment PCAS_102780 serine C-palmitoyltransferase, putative 9307527:9309236 forward MW:64703
Sequence
MSINKLMNANCGIEFDTIYQSNVVNYLIAIIILFAIILAIFNEDAAPGSPKLSWILGEFL
PMPHSLFGGNSYIENKLFKKKRDRKISTFISLIYQLIIKLKKSISEGKLIDLLKEWKTYA
IGKLSLYKNYAILNYKAESKKHIFYLLLKQKYNLPIKKNEKEYESYIDAKRELIKRDKWA
YMLRVSDVKNEYILCENKKVRTMSSYSYLDFVREPEVQNYAIKIASEWSTGNHGPRMLGG
NSQILRDLEKKLGQFYGRNDSILSVCGFLACMSGILAVSTPADLVLYDNRTHTCVKIGIQ
TSGAKAFSFKHNDYNDLELLLLKHRSKYRNCWVCLESVYSMDGDIPHLPSFKKLCIKYNS
RLFVDEAHGLGVLGKTGRGLEEYYNMPGSVDMIVGTFSKSISSVGGFIVASDEVIEFLDI
HCIGNVFSAPLPAYCAGAALKALELMDSQPWRIEKLKFNSKYLRNGLKTGLNLWPPNYPE
CNKYIIEGDDDTSVIPVVYPNDADRLLKICTLLRTKKWLVSAVIYPACPLKYPRFRVTAT
CAYTVECMNEFITDLVNITVSVPPSPIES
Download sequence
Identical sequences A0A077YDX7 A0A1C6XRN3
PCAS_102780 XP_745928.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]