SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_132310 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_132310
Domain Number 1 Region: 13-483
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.49e-77
Family GABA-aminotransferase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PCAS_132310
Sequence length 484
Comment PCAS_132310 serine hydroxymethyltransferase, putative 14174624:14176078 reverse MW:57289
Sequence
MKIVKELCKKGKVKWRRYISSQSLQNYNSLKNVDEDNYNILSTYKNKSYLNLSVCNNVIP
KYVHDCLVNNLNKNVTLNLEHLKIIEDRALAAFNLENKYWGCVFNTSSHSECTNSMDEYF
LLKLFRNFVNYQSKIMIISFTLLDKETHEENNKEENRTDKNVLNEFYNILYIKNNDKINY
MEIKNQYEQFKPDLIYIDETNNPYNFDYEFITTLRNMKSKINNNVNSEKEGVEDKSNTLV
MTNISNKASFIIEKFISSPFSQADIVFSYLNENIRANNCYIIFYRKGFKNISTQGKLICY
EYEEKLKKTFFQNNVNNIICSLSTSFKCIQNHEFKEYIHQINKNINVLFSYLNKKYFNIH
FDQNNNFLNIACSNSLFNIQEYHMFCKKINILFDIININKSIYPQKSFNIGTNYLTALGM
EEHDMKYVSEFINQSILLYLYTKQKSANSNLTFLEYLENNFISSDILALSNDIHSFVSMF
PSPS
Download sequence
Identical sequences A0A077TQS9
PCAS_132310 XP_744357.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]