SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PCAS_146150 from Plasmodium chabaudi

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PCAS_146150
Domain Number 1 Region: 243-613
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.46e-93
Family GABA-aminotransferase-like 0.000000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PCAS_146150
Sequence length 627
Comment PCAS_146150 delta-aminolevulinic acid synthetase, putative 18131506:18133564 forward MW:72624
Sequence
MRKKKALKVSLDEIKKYCPFVKNIKIFYENHEKKNNVVLSVMSNLCPIGKAINKKHLIVI
DNKSKINIFKILRGHNLCSRQNVEECIKKNNVIIEGKCKHLETENNDLYLYEHEIKNNNS
CNENAILEILKSPYNIFQNECNNDLKELINKLFIDKRYRIFTILNKLRKIYPNVYIENNK
LLLSSFYEFYQKFGYKLCIGASPYNIKRVLDCSTIKLDYTMDKIKEISHENNSVNKLKDI
CNINLNDFRKRGITNDKTVIWCSNDYLSLSNNEQVIDVGIETLKKIGNSSGGTRNISGSL
LNHTHLEYILARWFNKESALLFTSGYIANMGALGTLGKLLNLVFVSDQMNHASIINGIQE
SRCEKYIFKHNDMTDLENVLKRLRMKKEYKNRKIMIVFESIYSMSGNISDIKKIVQLAKK
YNALTYIDEVHAVGLYGKTGSGYSEELNLCDEIDIINGTLSKAIGSLGGFICANKYYIDV
IRSYSPHFIFTTSLTPVNITTSAEAIYIIQNDMELRNRFRHVVNRTKEKLKERGILIIDN
DSHIVVTLINCPQKCKQICDDLLTMYNIYLQPINYPTVPKGSERIRITPSPYHTEEQISK
LADSLYTLFKKYEVNMFNKKNKIEMRL
Download sequence
Identical sequences A0A077TVQ0
PCAS_146150 XP_742225.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]