SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386743495|ref|YP_006216674.1| from Providencia stuartii MRSN 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386743495|ref|YP_006216674.1|
Domain Number 1 Region: 10-323
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.09e-61
Family ADP-ribosylglycohydrolase 0.0000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386743495|ref|YP_006216674.1|
Sequence length 336
Comment ADP-ribosylation/crystallin J1 [Providencia stuartii MRSN 2154]
Sequence
MGLKPNIEAAILGCLYGQATGDAMGMPSELWRQDKVQQFFGWIDHFLPGPDENIAAIGFR
AGEVTDDTHQAIALMDAIIACNGQVEPKVVAQNILAWADRINAFDKNIFGPTSKQSLLAI
QAGVPINDIVSNGVTNGAAMRIAPVGCIASTADRNQFIKTVEAACIPTHKSDIAIAGACV
IAWAISRAIEQTPWPQIKQELPLLADEVQQLYASTFSPSLGQRILLAFKKASELQTCSPQ
TTLKELYDFIGAGMDTIESIPCALAIVDLTNGDPVMCAKYCANLGGDTDTIGAMAGAISG
ALSGIQSFPEEWIAMINNSNNIDFYPYAKILSALRH
Download sequence
Identical sequences A0A140NM89 A0A1L3IIS1
WP_014657179.1.14752 WP_014657179.1.36897 WP_014657179.1.40371 WP_014657179.1.75872 WP_014657179.1.87806 WP_014657179.1.92202 WP_014657179.1.96853 gi|386743495|ref|YP_006216674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]