SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386744167|ref|YP_006217346.1| from Providencia stuartii MRSN 2154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386744167|ref|YP_006217346.1|
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000182
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386744167|ref|YP_006217346.1|
Sequence length 96
Comment hypothetical protein S70_14115 [Providencia stuartii MRSN 2154]
Sequence
MSHDLTWEKSSSALLLSGTLGRDSLLVFWEKRKSLLAEVEQIDVSGLEHVDSTGLAMLVR
LKGELATEKRSLKIVGMSDNLTTLMELYGVKSLLLS
Download sequence
Identical sequences A0A140NNG7 A0A1L3IJZ6 B2PXJ3
gi|386744167|ref|YP_006217346.1| WP_004925456.1.14119 WP_004925456.1.14752 WP_004925456.1.36897 WP_004925456.1.40371 WP_004925456.1.72357 WP_004925456.1.75872 WP_004925456.1.85859 WP_004925456.1.87806 WP_004925456.1.92202 WP_004925456.1.96853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]