SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|207856820|ref|YP_002243471.1| from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|207856820|ref|YP_002243471.1|
Domain Number 1 Region: 49-220
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.23e-25
Family B3/B4 domain of PheRS, PheT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|207856820|ref|YP_002243471.1|
Sequence length 228
Comment hypothetical protein SEN1366 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
Sequence
MSSMLPSISPELARIAPGFRALSINVIAAPIRDAQVGEIALKEACQAVINGQPTWAQAHI
DAWNAVFKAFGAKPKRTPCSAEALRKRVLKDGTMAALDPVVDLYNAVSLRYAVPVGGENS
AAYCGSPRLVFADGSETFDTLKEGQPVTESPEPGEVIWRDDRGVTCRRWNWRQGVRTRLS
ASDKAMWFILESLPEMPVDELYAAGNMLTDGLEKMMPGLRFESTLMGV
Download sequence
Identical sequences A0A1R2H7D0 A0A1S0ZKR3 A0A2D1XRL3 A0A2I6NDF5 A0A2I6NR08 A0A2J0RRC6 A0A2K2K9S0
gi|207856820|ref|YP_002243471.1| WP_000097255.1.100077 WP_000097255.1.100191 WP_000097255.1.100392 WP_000097255.1.100412 WP_000097255.1.100457 WP_000097255.1.100557 WP_000097255.1.100605 WP_000097255.1.100776 WP_000097255.1.10081 WP_000097255.1.100857 WP_000097255.1.100895 WP_000097255.1.101112 WP_000097255.1.101425 WP_000097255.1.101541 WP_000097255.1.101634 WP_000097255.1.101674 WP_000097255.1.10177 WP_000097255.1.101832 WP_000097255.1.101917 WP_000097255.1.102111 WP_000097255.1.10300 WP_000097255.1.10498 WP_000097255.1.10631 WP_000097255.1.10755 WP_000097255.1.10868 WP_000097255.1.10898 WP_000097255.1.11041 WP_000097255.1.11119 WP_000097255.1.11216 WP_000097255.1.113 WP_000097255.1.1150 WP_000097255.1.11526 WP_000097255.1.11528 WP_000097255.1.1156 WP_000097255.1.1169 WP_000097255.1.1174 WP_000097255.1.11824 WP_000097255.1.11841 WP_000097255.1.11900 WP_000097255.1.11978 WP_000097255.1.12027 WP_000097255.1.12106 WP_000097255.1.1215 WP_000097255.1.12168 WP_000097255.1.12340 WP_000097255.1.12374 WP_000097255.1.12485 WP_000097255.1.12568 WP_000097255.1.12569 WP_000097255.1.12585 WP_000097255.1.12696 WP_000097255.1.1299 WP_000097255.1.1300 WP_000097255.1.13076 WP_000097255.1.13102 WP_000097255.1.13247 WP_000097255.1.13274 WP_000097255.1.13367 WP_000097255.1.13391 WP_000097255.1.1346 WP_000097255.1.13573 WP_000097255.1.13625 WP_000097255.1.1412 WP_000097255.1.146 WP_000097255.1.14708 WP_000097255.1.14793 WP_000097255.1.14819 WP_000097255.1.14913 WP_000097255.1.15067 WP_000097255.1.15276 WP_000097255.1.15318 WP_000097255.1.15585 WP_000097255.1.15616 WP_000097255.1.1568 WP_000097255.1.15775 WP_000097255.1.15777 WP_000097255.1.16201 WP_000097255.1.16363 WP_000097255.1.16365 WP_000097255.1.16366 WP_000097255.1.16394 WP_000097255.1.16453 WP_000097255.1.16474 WP_000097255.1.16729 WP_000097255.1.16817 WP_000097255.1.16949 WP_000097255.1.16972 WP_000097255.1.17060 WP_000097255.1.17096 WP_000097255.1.17105 WP_000097255.1.1733 WP_000097255.1.17482 WP_000097255.1.17525 WP_000097255.1.17583 WP_000097255.1.17732 WP_000097255.1.17886 WP_000097255.1.17914 WP_000097255.1.17936 WP_000097255.1.18056 WP_000097255.1.18061 WP_000097255.1.18092 WP_000097255.1.18103 WP_000097255.1.18109 WP_000097255.1.18149 WP_000097255.1.18384 WP_000097255.1.18641 WP_000097255.1.18686 WP_000097255.1.18737 WP_000097255.1.18847 WP_000097255.1.18886 WP_000097255.1.18895 WP_000097255.1.1895 WP_000097255.1.19093 WP_000097255.1.19340 WP_000097255.1.19373 WP_000097255.1.19433 WP_000097255.1.1954 WP_000097255.1.1955 WP_000097255.1.19656 WP_000097255.1.19834 WP_000097255.1.19863 WP_000097255.1.19884 WP_000097255.1.19970 WP_000097255.1.19987 WP_000097255.1.20086 WP_000097255.1.20091 WP_000097255.1.20261 WP_000097255.1.20349 WP_000097255.1.2041 WP_000097255.1.20437 WP_000097255.1.20894 WP_000097255.1.2107 WP_000097255.1.21079 WP_000097255.1.21103 WP_000097255.1.2116 WP_000097255.1.21181 WP_000097255.1.21194 WP_000097255.1.21202 WP_000097255.1.21241 WP_000097255.1.2130 WP_000097255.1.21332 WP_000097255.1.21423 WP_000097255.1.21681 WP_000097255.1.21715 WP_000097255.1.21877 WP_000097255.1.21909 WP_000097255.1.21950 WP_000097255.1.22051 WP_000097255.1.22096 WP_000097255.1.22136 WP_000097255.1.22158 WP_000097255.1.22162 WP_000097255.1.22296 WP_000097255.1.22346 WP_000097255.1.22388 WP_000097255.1.22449 WP_000097255.1.22454 WP_000097255.1.22460 WP_000097255.1.22595 WP_000097255.1.22605 WP_000097255.1.22760 WP_000097255.1.22855 WP_000097255.1.22857 WP_000097255.1.22880 WP_000097255.1.22902 WP_000097255.1.22947 WP_000097255.1.23201 WP_000097255.1.2324 WP_000097255.1.23329 WP_000097255.1.23442 WP_000097255.1.2358 WP_000097255.1.23631 WP_000097255.1.23746 WP_000097255.1.24145 WP_000097255.1.24163 WP_000097255.1.24214 WP_000097255.1.24250 WP_000097255.1.24297 WP_000097255.1.24361 WP_000097255.1.24408 WP_000097255.1.24409 WP_000097255.1.24433 WP_000097255.1.24476 WP_000097255.1.24494 WP_000097255.1.24673 WP_000097255.1.24727 WP_000097255.1.24901 WP_000097255.1.24944 WP_000097255.1.25159 WP_000097255.1.25175 WP_000097255.1.25217 WP_000097255.1.25354 WP_000097255.1.25426 WP_000097255.1.25596 WP_000097255.1.25618 WP_000097255.1.25722 WP_000097255.1.25780 WP_000097255.1.25951 WP_000097255.1.26075 WP_000097255.1.26083 WP_000097255.1.26194 WP_000097255.1.26213 WP_000097255.1.26441 WP_000097255.1.26563 WP_000097255.1.26687 WP_000097255.1.2672 WP_000097255.1.26758 WP_000097255.1.26794 WP_000097255.1.26936 WP_000097255.1.27122 WP_000097255.1.27169 WP_000097255.1.27272 WP_000097255.1.27314 WP_000097255.1.27383 WP_000097255.1.27547 WP_000097255.1.27632 WP_000097255.1.27638 WP_000097255.1.27658 WP_000097255.1.27800 WP_000097255.1.27833 WP_000097255.1.27883 WP_000097255.1.27995 WP_000097255.1.28037 WP_000097255.1.28056 WP_000097255.1.28139 WP_000097255.1.28200 WP_000097255.1.28232 WP_000097255.1.28233 WP_000097255.1.28303 WP_000097255.1.28462 WP_000097255.1.2853 WP_000097255.1.28570 WP_000097255.1.28620 WP_000097255.1.28773 WP_000097255.1.29168 WP_000097255.1.29218 WP_000097255.1.2924 WP_000097255.1.2932 WP_000097255.1.29379 WP_000097255.1.29422 WP_000097255.1.29436 WP_000097255.1.29576 WP_000097255.1.3005 WP_000097255.1.30059 WP_000097255.1.30165 WP_000097255.1.30210 WP_000097255.1.30278 WP_000097255.1.30389 WP_000097255.1.30492 WP_000097255.1.30548 WP_000097255.1.30589 WP_000097255.1.30627 WP_000097255.1.30752 WP_000097255.1.3095 WP_000097255.1.30968 WP_000097255.1.31042 WP_000097255.1.31167 WP_000097255.1.31272 WP_000097255.1.31335 WP_000097255.1.31435 WP_000097255.1.31585 WP_000097255.1.3167 WP_000097255.1.31895 WP_000097255.1.31901 WP_000097255.1.32038 WP_000097255.1.32054 WP_000097255.1.32109 WP_000097255.1.32116 WP_000097255.1.32252 WP_000097255.1.32274 WP_000097255.1.32309 WP_000097255.1.32459 WP_000097255.1.32519 WP_000097255.1.32668 WP_000097255.1.32740 WP_000097255.1.32832 WP_000097255.1.32881 WP_000097255.1.32899 WP_000097255.1.32977 WP_000097255.1.3310 WP_000097255.1.33253 WP_000097255.1.33270 WP_000097255.1.33409 WP_000097255.1.335 WP_000097255.1.3356 WP_000097255.1.33586 WP_000097255.1.3364 WP_000097255.1.3396 WP_000097255.1.34 WP_000097255.1.34091 WP_000097255.1.34184 WP_000097255.1.34185 WP_000097255.1.34292 WP_000097255.1.3438 WP_000097255.1.34431 WP_000097255.1.34454 WP_000097255.1.34614 WP_000097255.1.34647 WP_000097255.1.34711 WP_000097255.1.34820 WP_000097255.1.35125 WP_000097255.1.35294 WP_000097255.1.35298 WP_000097255.1.35321 WP_000097255.1.35563 WP_000097255.1.35570 WP_000097255.1.35594 WP_000097255.1.35624 WP_000097255.1.35887 WP_000097255.1.35936 WP_000097255.1.35961 WP_000097255.1.36037 WP_000097255.1.36063 WP_000097255.1.3610 WP_000097255.1.36409 WP_000097255.1.36445 WP_000097255.1.36564 WP_000097255.1.36584 WP_000097255.1.36652 WP_000097255.1.36685 WP_000097255.1.36721 WP_000097255.1.36751 WP_000097255.1.36764 WP_000097255.1.36889 WP_000097255.1.37029 WP_000097255.1.37114 WP_000097255.1.37191 WP_000097255.1.37297 WP_000097255.1.37405 WP_000097255.1.3748 WP_000097255.1.3771 WP_000097255.1.3778 WP_000097255.1.37864 WP_000097255.1.3790 WP_000097255.1.38037 WP_000097255.1.38047 WP_000097255.1.38344 WP_000097255.1.39048 WP_000097255.1.39055 WP_000097255.1.39065 WP_000097255.1.39312 WP_000097255.1.39395 WP_000097255.1.40081 WP_000097255.1.40307 WP_000097255.1.40493 WP_000097255.1.40533 WP_000097255.1.40577 WP_000097255.1.40605 WP_000097255.1.40622 WP_000097255.1.40695 WP_000097255.1.40745 WP_000097255.1.40849 WP_000097255.1.4088 WP_000097255.1.40930 WP_000097255.1.40973 WP_000097255.1.41116 WP_000097255.1.41128 WP_000097255.1.41192 WP_000097255.1.41277 WP_000097255.1.41427 WP_000097255.1.41468 WP_000097255.1.41528 WP_000097255.1.41610 WP_000097255.1.41688 WP_000097255.1.41690 WP_000097255.1.41799 WP_000097255.1.41897 WP_000097255.1.41911 WP_000097255.1.41949 WP_000097255.1.41978 WP_000097255.1.42136 WP_000097255.1.422 WP_000097255.1.42263 WP_000097255.1.42322 WP_000097255.1.42392 WP_000097255.1.42666 WP_000097255.1.42675 WP_000097255.1.42683 WP_000097255.1.42734 WP_000097255.1.42892 WP_000097255.1.42932 WP_000097255.1.42978 WP_000097255.1.43201 WP_000097255.1.43258 WP_000097255.1.4344 WP_000097255.1.43685 WP_000097255.1.43711 WP_000097255.1.43785 WP_000097255.1.43864 WP_000097255.1.44010 WP_000097255.1.44337 WP_000097255.1.44474 WP_000097255.1.44549 WP_000097255.1.44705 WP_000097255.1.44795 WP_000097255.1.44831 WP_000097255.1.44966 WP_000097255.1.44978 WP_000097255.1.44997 WP_000097255.1.4500 WP_000097255.1.45173 WP_000097255.1.45302 WP_000097255.1.4531 WP_000097255.1.45432 WP_000097255.1.45549 WP_000097255.1.45569 WP_000097255.1.45571 WP_000097255.1.45583 WP_000097255.1.45844 WP_000097255.1.45906 WP_000097255.1.45918 WP_000097255.1.46215 WP_000097255.1.46499 WP_000097255.1.46578 WP_000097255.1.46726 WP_000097255.1.4674 WP_000097255.1.4686 WP_000097255.1.46967 WP_000097255.1.46976 WP_000097255.1.47005 WP_000097255.1.47058 WP_000097255.1.47507 WP_000097255.1.47567 WP_000097255.1.47576 WP_000097255.1.4758 WP_000097255.1.47829 WP_000097255.1.47850 WP_000097255.1.47875 WP_000097255.1.47911 WP_000097255.1.4795 WP_000097255.1.47988 WP_000097255.1.4839 WP_000097255.1.48797 WP_000097255.1.49233 WP_000097255.1.49311 WP_000097255.1.49334 WP_000097255.1.49358 WP_000097255.1.49443 WP_000097255.1.49770 WP_000097255.1.50128 WP_000097255.1.50238 WP_000097255.1.50332 WP_000097255.1.50449 WP_000097255.1.50652 WP_000097255.1.50684 WP_000097255.1.50882 WP_000097255.1.50893 WP_000097255.1.50960 WP_000097255.1.51356 WP_000097255.1.51412 WP_000097255.1.51451 WP_000097255.1.51502 WP_000097255.1.51642 WP_000097255.1.51764 WP_000097255.1.51810 WP_000097255.1.51868 WP_000097255.1.51930 WP_000097255.1.51994 WP_000097255.1.520 WP_000097255.1.5211 WP_000097255.1.52301 WP_000097255.1.52321 WP_000097255.1.52582 WP_000097255.1.52586 WP_000097255.1.52824 WP_000097255.1.52833 WP_000097255.1.5301 WP_000097255.1.53107 WP_000097255.1.53119 WP_000097255.1.5313 WP_000097255.1.53198 WP_000097255.1.53206 WP_000097255.1.53234 WP_000097255.1.53274 WP_000097255.1.53362 WP_000097255.1.53385 WP_000097255.1.53567 WP_000097255.1.53664 WP_000097255.1.53778 WP_000097255.1.53781 WP_000097255.1.53896 WP_000097255.1.53961 WP_000097255.1.54283 WP_000097255.1.54366 WP_000097255.1.54500 WP_000097255.1.5459 WP_000097255.1.54615 WP_000097255.1.54833 WP_000097255.1.54877 WP_000097255.1.54936 WP_000097255.1.5525 WP_000097255.1.55361 WP_000097255.1.55559 WP_000097255.1.55640 WP_000097255.1.5572 WP_000097255.1.5577 WP_000097255.1.55923 WP_000097255.1.55948 WP_000097255.1.56130 WP_000097255.1.56152 WP_000097255.1.56235 WP_000097255.1.56263 WP_000097255.1.5668 WP_000097255.1.56851 WP_000097255.1.56861 WP_000097255.1.56898 WP_000097255.1.57026 WP_000097255.1.57039 WP_000097255.1.57056 WP_000097255.1.5711 WP_000097255.1.57143 WP_000097255.1.57246 WP_000097255.1.57296 WP_000097255.1.57362 WP_000097255.1.5753 WP_000097255.1.57559 WP_000097255.1.57631 WP_000097255.1.57641 WP_000097255.1.57835 WP_000097255.1.57893 WP_000097255.1.58090 WP_000097255.1.5828 WP_000097255.1.58290 WP_000097255.1.58443 WP_000097255.1.58486 WP_000097255.1.58489 WP_000097255.1.58675 WP_000097255.1.58884 WP_000097255.1.58926 WP_000097255.1.58932 WP_000097255.1.59142 WP_000097255.1.59163 WP_000097255.1.59427 WP_000097255.1.59538 WP_000097255.1.59548 WP_000097255.1.59562 WP_000097255.1.59646 WP_000097255.1.59848 WP_000097255.1.60004 WP_000097255.1.60126 WP_000097255.1.60137 WP_000097255.1.60320 WP_000097255.1.6033 WP_000097255.1.60469 WP_000097255.1.60560 WP_000097255.1.60713 WP_000097255.1.608 WP_000097255.1.60866 WP_000097255.1.60897 WP_000097255.1.61200 WP_000097255.1.61356 WP_000097255.1.61381 WP_000097255.1.61434 WP_000097255.1.61501 WP_000097255.1.61594 WP_000097255.1.61595 WP_000097255.1.61671 WP_000097255.1.61908 WP_000097255.1.62158 WP_000097255.1.62201 WP_000097255.1.62210 WP_000097255.1.62310 WP_000097255.1.62412 WP_000097255.1.627 WP_000097255.1.62745 WP_000097255.1.62757 WP_000097255.1.62828 WP_000097255.1.6292 WP_000097255.1.62983 WP_000097255.1.62988 WP_000097255.1.63045 WP_000097255.1.63102 WP_000097255.1.63229 WP_000097255.1.63497 WP_000097255.1.63509 WP_000097255.1.63513 WP_000097255.1.63529 WP_000097255.1.63585 WP_000097255.1.63603 WP_000097255.1.63633 WP_000097255.1.6370 WP_000097255.1.63748 WP_000097255.1.63851 WP_000097255.1.63863 WP_000097255.1.64010 WP_000097255.1.64085 WP_000097255.1.64109 WP_000097255.1.64157 WP_000097255.1.64229 WP_000097255.1.64350 WP_000097255.1.64385 WP_000097255.1.64412 WP_000097255.1.64462 WP_000097255.1.64500 WP_000097255.1.64597 WP_000097255.1.64711 WP_000097255.1.65011 WP_000097255.1.6525 WP_000097255.1.65295 WP_000097255.1.65357 WP_000097255.1.65601 WP_000097255.1.65698 WP_000097255.1.65771 WP_000097255.1.65881 WP_000097255.1.65883 WP_000097255.1.65901 WP_000097255.1.6595 WP_000097255.1.66082 WP_000097255.1.66171 WP_000097255.1.66315 WP_000097255.1.66385 WP_000097255.1.66400 WP_000097255.1.66428 WP_000097255.1.66446 WP_000097255.1.66539 WP_000097255.1.66733 WP_000097255.1.66800 WP_000097255.1.6692 WP_000097255.1.66959 WP_000097255.1.67075 WP_000097255.1.6710 WP_000097255.1.67173 WP_000097255.1.67279 WP_000097255.1.6760 WP_000097255.1.67603 WP_000097255.1.67731 WP_000097255.1.6782 WP_000097255.1.67932 WP_000097255.1.67970 WP_000097255.1.68075 WP_000097255.1.68140 WP_000097255.1.68159 WP_000097255.1.68167 WP_000097255.1.68629 WP_000097255.1.68652 WP_000097255.1.68677 WP_000097255.1.68893 WP_000097255.1.68895 WP_000097255.1.69080 WP_000097255.1.69086 WP_000097255.1.69131 WP_000097255.1.69139 WP_000097255.1.69236 WP_000097255.1.69273 WP_000097255.1.69357 WP_000097255.1.69485 WP_000097255.1.69575 WP_000097255.1.69616 WP_000097255.1.69767 WP_000097255.1.69890 WP_000097255.1.69965 WP_000097255.1.70087 WP_000097255.1.70088 WP_000097255.1.70272 WP_000097255.1.70440 WP_000097255.1.70531 WP_000097255.1.7055 WP_000097255.1.70596 WP_000097255.1.70678 WP_000097255.1.70785 WP_000097255.1.70837 WP_000097255.1.70985 WP_000097255.1.71172 WP_000097255.1.71184 WP_000097255.1.71201 WP_000097255.1.71305 WP_000097255.1.71626 WP_000097255.1.71649 WP_000097255.1.71667 WP_000097255.1.71979 WP_000097255.1.71984 WP_000097255.1.720 WP_000097255.1.72100 WP_000097255.1.72190 WP_000097255.1.72221 WP_000097255.1.72300 WP_000097255.1.72325 WP_000097255.1.72339 WP_000097255.1.72532 WP_000097255.1.72602 WP_000097255.1.72716 WP_000097255.1.72718 WP_000097255.1.72865 WP_000097255.1.7295 WP_000097255.1.73068 WP_000097255.1.7316 WP_000097255.1.73708 WP_000097255.1.74174 WP_000097255.1.74207 WP_000097255.1.74248 WP_000097255.1.743 WP_000097255.1.74300 WP_000097255.1.74402 WP_000097255.1.74428 WP_000097255.1.74578 WP_000097255.1.74632 WP_000097255.1.74972 WP_000097255.1.75051 WP_000097255.1.75056 WP_000097255.1.75148 WP_000097255.1.75159 WP_000097255.1.75400 WP_000097255.1.75450 WP_000097255.1.7558 WP_000097255.1.75607 WP_000097255.1.75716 WP_000097255.1.75751 WP_000097255.1.75794 WP_000097255.1.75810 WP_000097255.1.75863 WP_000097255.1.75902 WP_000097255.1.76108 WP_000097255.1.76137 WP_000097255.1.76345 WP_000097255.1.76451 WP_000097255.1.76495 WP_000097255.1.7655 WP_000097255.1.76776 WP_000097255.1.76913 WP_000097255.1.76968 WP_000097255.1.77306 WP_000097255.1.77356 WP_000097255.1.77475 WP_000097255.1.77496 WP_000097255.1.77565 WP_000097255.1.7792 WP_000097255.1.7793 WP_000097255.1.77951 WP_000097255.1.77983 WP_000097255.1.77989 WP_000097255.1.78016 WP_000097255.1.7802 WP_000097255.1.78051 WP_000097255.1.78443 WP_000097255.1.78501 WP_000097255.1.78502 WP_000097255.1.78603 WP_000097255.1.78632 WP_000097255.1.78658 WP_000097255.1.78697 WP_000097255.1.78734 WP_000097255.1.7877 WP_000097255.1.78815 WP_000097255.1.78877 WP_000097255.1.78896 WP_000097255.1.79099 WP_000097255.1.79289 WP_000097255.1.79468 WP_000097255.1.7956 WP_000097255.1.79580 WP_000097255.1.79586 WP_000097255.1.7982 WP_000097255.1.80249 WP_000097255.1.80254 WP_000097255.1.80333 WP_000097255.1.80380 WP_000097255.1.80760 WP_000097255.1.80840 WP_000097255.1.80874 WP_000097255.1.80876 WP_000097255.1.8106 WP_000097255.1.81062 WP_000097255.1.81107 WP_000097255.1.81109 WP_000097255.1.81110 WP_000097255.1.81197 WP_000097255.1.81225 WP_000097255.1.8130 WP_000097255.1.8134 WP_000097255.1.81388 WP_000097255.1.81668 WP_000097255.1.81768 WP_000097255.1.82144 WP_000097255.1.82149 WP_000097255.1.82401 WP_000097255.1.82420 WP_000097255.1.82434 WP_000097255.1.8247 WP_000097255.1.82474 WP_000097255.1.82569 WP_000097255.1.83005 WP_000097255.1.83006 WP_000097255.1.83204 WP_000097255.1.83331 WP_000097255.1.83354 WP_000097255.1.83356 WP_000097255.1.83558 WP_000097255.1.8399 WP_000097255.1.84000 WP_000097255.1.84011 WP_000097255.1.84075 WP_000097255.1.84083 WP_000097255.1.84086 WP_000097255.1.84154 WP_000097255.1.84205 WP_000097255.1.84300 WP_000097255.1.84497 WP_000097255.1.84515 WP_000097255.1.84572 WP_000097255.1.84598 WP_000097255.1.84876 WP_000097255.1.84983 WP_000097255.1.85079 WP_000097255.1.85126 WP_000097255.1.8526 WP_000097255.1.85271 WP_000097255.1.85301 WP_000097255.1.85654 WP_000097255.1.85759 WP_000097255.1.85982 WP_000097255.1.86126 WP_000097255.1.86138 WP_000097255.1.86157 WP_000097255.1.8616 WP_000097255.1.86316 WP_000097255.1.86380 WP_000097255.1.8647 WP_000097255.1.86514 WP_000097255.1.86610 WP_000097255.1.86915 WP_000097255.1.87038 WP_000097255.1.87187 WP_000097255.1.87265 WP_000097255.1.87484 WP_000097255.1.87500 WP_000097255.1.87583 WP_000097255.1.87712 WP_000097255.1.87905 WP_000097255.1.88052 WP_000097255.1.88185 WP_000097255.1.88275 WP_000097255.1.88356 WP_000097255.1.88474 WP_000097255.1.88483 WP_000097255.1.88508 WP_000097255.1.88731 WP_000097255.1.88854 WP_000097255.1.88966 WP_000097255.1.88968 WP_000097255.1.88998 WP_000097255.1.89120 WP_000097255.1.89177 WP_000097255.1.89221 WP_000097255.1.89362 WP_000097255.1.89408 WP_000097255.1.89425 WP_000097255.1.89606 WP_000097255.1.8961 WP_000097255.1.89634 WP_000097255.1.89680 WP_000097255.1.89746 WP_000097255.1.89832 WP_000097255.1.9003 WP_000097255.1.90421 WP_000097255.1.90522 WP_000097255.1.90540 WP_000097255.1.90563 WP_000097255.1.90701 WP_000097255.1.90748 WP_000097255.1.90759 WP_000097255.1.90859 WP_000097255.1.9089 WP_000097255.1.90959 WP_000097255.1.90973 WP_000097255.1.91215 WP_000097255.1.9137 WP_000097255.1.91372 WP_000097255.1.91424 WP_000097255.1.91474 WP_000097255.1.91505 WP_000097255.1.91742 WP_000097255.1.91772 WP_000097255.1.91776 WP_000097255.1.91795 WP_000097255.1.91898 WP_000097255.1.91904 WP_000097255.1.91914 WP_000097255.1.91974 WP_000097255.1.92039 WP_000097255.1.92082 WP_000097255.1.92129 WP_000097255.1.9222 WP_000097255.1.92452 WP_000097255.1.9253 WP_000097255.1.92557 WP_000097255.1.92628 WP_000097255.1.92806 WP_000097255.1.92890 WP_000097255.1.92929 WP_000097255.1.93076 WP_000097255.1.93215 WP_000097255.1.93350 WP_000097255.1.93524 WP_000097255.1.93577 WP_000097255.1.9380 WP_000097255.1.93809 WP_000097255.1.9440 WP_000097255.1.94473 WP_000097255.1.94588 WP_000097255.1.94598 WP_000097255.1.94649 WP_000097255.1.94670 WP_000097255.1.94817 WP_000097255.1.94835 WP_000097255.1.95136 WP_000097255.1.9527 WP_000097255.1.95434 WP_000097255.1.95447 WP_000097255.1.95456 WP_000097255.1.95465 WP_000097255.1.95656 WP_000097255.1.95757 WP_000097255.1.95803 WP_000097255.1.9586 WP_000097255.1.95866 WP_000097255.1.95901 WP_000097255.1.95963 WP_000097255.1.96107 WP_000097255.1.9624 WP_000097255.1.96340 WP_000097255.1.96348 WP_000097255.1.96349 WP_000097255.1.96380 WP_000097255.1.96521 WP_000097255.1.96537 WP_000097255.1.96588 WP_000097255.1.96735 WP_000097255.1.96876 WP_000097255.1.96993 WP_000097255.1.97103 WP_000097255.1.97322 WP_000097255.1.97328 WP_000097255.1.97547 WP_000097255.1.97648 WP_000097255.1.97656 WP_000097255.1.97704 WP_000097255.1.9774 WP_000097255.1.97800 WP_000097255.1.97907 WP_000097255.1.9793 WP_000097255.1.97981 WP_000097255.1.97991 WP_000097255.1.98119 WP_000097255.1.98338 WP_000097255.1.98440 WP_000097255.1.98472 WP_000097255.1.98570 WP_000097255.1.98726 WP_000097255.1.9899 WP_000097255.1.99057 WP_000097255.1.99083 WP_000097255.1.99097 WP_000097255.1.99164 WP_000097255.1.99198 WP_000097255.1.99215 WP_000097255.1.99456 WP_000097255.1.99490 WP_000097255.1.99493 WP_000097255.1.99613 WP_000097255.1.99630 WP_000097255.1.99924 WP_000097255.1.99961 ABEH02000002|CDS_416341-417027 AM933172|CDS_1458142-1457456 550537.SEN1366 gi|452120153|ref|YP_007470401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]