SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|207857155|ref|YP_002243806.1| from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|207857155|ref|YP_002243806.1|
Domain Number 1 Region: 195-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.62e-78
Family B3/B4 domain of PheRS, PheT 0.00000604
Further Details:      
 
Domain Number 2 Region: 467-690
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.84e-56
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000935
Further Details:      
 
Domain Number 3 Region: 35-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.13e-51
Family Myf domain 0.0027
Further Details:      
 
Domain Number 4 Region: 696-794
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.4e-31
Family Anticodon-binding domain of PheRS 0.00073
Further Details:      
 
Domain Number 5 Region: 403-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 7.32e-21
Family Domains B1 and B5 of PheRS-beta, PheT 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|207857155|ref|YP_002243806.1|
Sequence length 795
Comment phenylalanyl-tRNA synthetase subunit beta [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
Sequence
MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFNGVVVGEVVECAQHPNAD
KLRVTKVNVGGERLLDIVCGAPNCRQGLKVAVATIGAILPGDFKIKAAKLRGEPSEGMLC
SFSELGISDDHSGIIELPADAPLGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDVA
VLNKAPLQEPEMVPVTATISDTLPITVEAADACPRYLGRVVKGINVNAPTPLWMKEKLRR
CGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIDGGIVVRMAKEGETVVLLDGSEATLNAD
TLVIADHHKALGIAGIFGGEHSGVNGETQNVLLECAYFNPLSITGRARRHGLHTDASHRY
ERGVDPALQYKAIERATRLLLDICGGDAGPIIDVSNEATLPKRATITLRRSKLDRLIGHH
IADEQVSDILRRLGCEVTEGQDEWKAVAPTWRFDMEIEEDLVEEVARVYGYNNIPDEPIQ
AGLIMGTHREADLSLKRVKTMLNDKGYQEVITYSFVDPKVQQLIHPGAEALLLPNPISVE
MSAMRLSLWSGLLATVVYNQNRQQNRVRIFETGLRFVPDTQANLGIRQDLMLAGVICGNR
YDEHWNLAKETVDFYDLKGDLEAVLDLTGKLGDIQFKAEMNPALHPGQSAAIYLKDERIG
FIGVVHPELERKLDLNGRTLVFELEWNKLADRIVPQAREISRFPANRRDIAVVVAENVPA
ADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDTNRTLEEEEIAATVAK
CVEALKERFQASLRD
Download sequence
Identical sequences A0A0H3BTN9 A0A0R9PZN1 A0A1R2T6L4 A0A1S1AEK9 A0A2J0RXI5 B5RAW8 S4HXV2
gi|528819123|ref|YP_008360326.1| gi|161614254|ref|YP_001588219.1| gi|194445753|ref|YP_002040595.1| WP_000672408.1.100077 WP_000672408.1.100115 WP_000672408.1.100129 WP_000672408.1.100149 WP_000672408.1.100191 WP_000672408.1.100288 WP_000672408.1.100392 WP_000672408.1.100412 WP_000672408.1.100502 WP_000672408.1.100519 WP_000672408.1.100521 WP_000672408.1.100541 WP_000672408.1.100557 WP_000672408.1.100605 WP_000672408.1.100650 WP_000672408.1.100707 WP_000672408.1.100711 WP_000672408.1.100776 WP_000672408.1.10081 WP_000672408.1.100857 WP_000672408.1.100870 WP_000672408.1.100895 WP_000672408.1.101042 WP_000672408.1.101112 WP_000672408.1.101541 WP_000672408.1.101612 WP_000672408.1.101634 WP_000672408.1.101674 WP_000672408.1.101832 WP_000672408.1.101917 WP_000672408.1.102111 WP_000672408.1.10300 WP_000672408.1.10310 WP_000672408.1.10498 WP_000672408.1.10568 WP_000672408.1.10631 WP_000672408.1.10675 WP_000672408.1.10720 WP_000672408.1.10755 WP_000672408.1.10868 WP_000672408.1.10898 WP_000672408.1.11119 WP_000672408.1.11216 WP_000672408.1.11362 WP_000672408.1.1150 WP_000672408.1.11526 WP_000672408.1.11528 WP_000672408.1.1156 WP_000672408.1.11565 WP_000672408.1.1169 WP_000672408.1.1174 WP_000672408.1.11824 WP_000672408.1.11841 WP_000672408.1.11900 WP_000672408.1.11978 WP_000672408.1.12027 WP_000672408.1.12106 WP_000672408.1.1215 WP_000672408.1.12168 WP_000672408.1.12244 WP_000672408.1.12340 WP_000672408.1.12374 WP_000672408.1.12485 WP_000672408.1.12568 WP_000672408.1.12569 WP_000672408.1.12584 WP_000672408.1.12585 WP_000672408.1.12696 WP_000672408.1.1300 WP_000672408.1.13076 WP_000672408.1.13102 WP_000672408.1.13247 WP_000672408.1.1326 WP_000672408.1.13274 WP_000672408.1.13367 WP_000672408.1.13391 WP_000672408.1.13446 WP_000672408.1.1346 WP_000672408.1.13573 WP_000672408.1.13625 WP_000672408.1.13677 WP_000672408.1.14041 WP_000672408.1.1412 WP_000672408.1.14286 WP_000672408.1.14505 WP_000672408.1.14516 WP_000672408.1.146 WP_000672408.1.14688 WP_000672408.1.14708 WP_000672408.1.14793 WP_000672408.1.14819 WP_000672408.1.14913 WP_000672408.1.14936 WP_000672408.1.15046 WP_000672408.1.15067 WP_000672408.1.15276 WP_000672408.1.15318 WP_000672408.1.15483 WP_000672408.1.15585 WP_000672408.1.15625 WP_000672408.1.1568 WP_000672408.1.15708 WP_000672408.1.15775 WP_000672408.1.15777 WP_000672408.1.15995 WP_000672408.1.16028 WP_000672408.1.16032 WP_000672408.1.16331 WP_000672408.1.16363 WP_000672408.1.16365 WP_000672408.1.16366 WP_000672408.1.16394 WP_000672408.1.16453 WP_000672408.1.16474 WP_000672408.1.16729 WP_000672408.1.16819 WP_000672408.1.1689 WP_000672408.1.16941 WP_000672408.1.16944 WP_000672408.1.16949 WP_000672408.1.16972 WP_000672408.1.17060 WP_000672408.1.17105 WP_000672408.1.17285 WP_000672408.1.1733 WP_000672408.1.1737 WP_000672408.1.17390 WP_000672408.1.17447 WP_000672408.1.17482 WP_000672408.1.17525 WP_000672408.1.17583 WP_000672408.1.17732 WP_000672408.1.17755 WP_000672408.1.17886 WP_000672408.1.17914 WP_000672408.1.17919 WP_000672408.1.17936 WP_000672408.1.17991 WP_000672408.1.18056 WP_000672408.1.18061 WP_000672408.1.18092 WP_000672408.1.18109 WP_000672408.1.18149 WP_000672408.1.18178 WP_000672408.1.18384 WP_000672408.1.18641 WP_000672408.1.18686 WP_000672408.1.18737 WP_000672408.1.18847 WP_000672408.1.18886 WP_000672408.1.1895 WP_000672408.1.1897 WP_000672408.1.19093 WP_000672408.1.19373 WP_000672408.1.19433 WP_000672408.1.1955 WP_000672408.1.19656 WP_000672408.1.19834 WP_000672408.1.19851 WP_000672408.1.19938 WP_000672408.1.20034 WP_000672408.1.20086 WP_000672408.1.20089 WP_000672408.1.20261 WP_000672408.1.20391 WP_000672408.1.2041 WP_000672408.1.20425 WP_000672408.1.20437 WP_000672408.1.2047 WP_000672408.1.20695 WP_000672408.1.20700 WP_000672408.1.20721 WP_000672408.1.20839 WP_000672408.1.2107 WP_000672408.1.21079 WP_000672408.1.21103 WP_000672408.1.2116 WP_000672408.1.21194 WP_000672408.1.21202 WP_000672408.1.21241 WP_000672408.1.21332 WP_000672408.1.21404 WP_000672408.1.21681 WP_000672408.1.21715 WP_000672408.1.21792 WP_000672408.1.21845 WP_000672408.1.21909 WP_000672408.1.21950 WP_000672408.1.22030 WP_000672408.1.22051 WP_000672408.1.22096 WP_000672408.1.22136 WP_000672408.1.22158 WP_000672408.1.22162 WP_000672408.1.2224 WP_000672408.1.22240 WP_000672408.1.22296 WP_000672408.1.22346 WP_000672408.1.22449 WP_000672408.1.22454 WP_000672408.1.22460 WP_000672408.1.22514 WP_000672408.1.22575 WP_000672408.1.22582 WP_000672408.1.22595 WP_000672408.1.22605 WP_000672408.1.22760 WP_000672408.1.22857 WP_000672408.1.22880 WP_000672408.1.22902 WP_000672408.1.22947 WP_000672408.1.2324 WP_000672408.1.23329 WP_000672408.1.23442 WP_000672408.1.23466 WP_000672408.1.23503 WP_000672408.1.2358 WP_000672408.1.23621 WP_000672408.1.23631 WP_000672408.1.23643 WP_000672408.1.23685 WP_000672408.1.23736 WP_000672408.1.23746 WP_000672408.1.23819 WP_000672408.1.24145 WP_000672408.1.24163 WP_000672408.1.24214 WP_000672408.1.24250 WP_000672408.1.24297 WP_000672408.1.24325 WP_000672408.1.24361 WP_000672408.1.24408 WP_000672408.1.24409 WP_000672408.1.24433 WP_000672408.1.24494 WP_000672408.1.24673 WP_000672408.1.24901 WP_000672408.1.24944 WP_000672408.1.25159 WP_000672408.1.25175 WP_000672408.1.2525 WP_000672408.1.25354 WP_000672408.1.25426 WP_000672408.1.25498 WP_000672408.1.2554 WP_000672408.1.25564 WP_000672408.1.25618 WP_000672408.1.25722 WP_000672408.1.25780 WP_000672408.1.25932 WP_000672408.1.25951 WP_000672408.1.26030 WP_000672408.1.26083 WP_000672408.1.26123 WP_000672408.1.26194 WP_000672408.1.26269 WP_000672408.1.2634 WP_000672408.1.26363 WP_000672408.1.26426 WP_000672408.1.26441 WP_000672408.1.2660 WP_000672408.1.26687 WP_000672408.1.2672 WP_000672408.1.26794 WP_000672408.1.26936 WP_000672408.1.27272 WP_000672408.1.27279 WP_000672408.1.27314 WP_000672408.1.27383 WP_000672408.1.27419 WP_000672408.1.27547 WP_000672408.1.27556 WP_000672408.1.27632 WP_000672408.1.27638 WP_000672408.1.27658 WP_000672408.1.27755 WP_000672408.1.27833 WP_000672408.1.27883 WP_000672408.1.27995 WP_000672408.1.28037 WP_000672408.1.28056 WP_000672408.1.28139 WP_000672408.1.28200 WP_000672408.1.28232 WP_000672408.1.28233 WP_000672408.1.28235 WP_000672408.1.28303 WP_000672408.1.28462 WP_000672408.1.2853 WP_000672408.1.28570 WP_000672408.1.28612 WP_000672408.1.28620 WP_000672408.1.287 WP_000672408.1.28733 WP_000672408.1.28773 WP_000672408.1.29130 WP_000672408.1.29168 WP_000672408.1.29218 WP_000672408.1.2924 WP_000672408.1.2932 WP_000672408.1.29379 WP_000672408.1.29422 WP_000672408.1.29436 WP_000672408.1.29576 WP_000672408.1.29774 WP_000672408.1.3005 WP_000672408.1.30059 WP_000672408.1.30165 WP_000672408.1.3017 WP_000672408.1.30179 WP_000672408.1.30210 WP_000672408.1.30238 WP_000672408.1.30278 WP_000672408.1.30492 WP_000672408.1.30548 WP_000672408.1.30573 WP_000672408.1.30589 WP_000672408.1.30602 WP_000672408.1.30627 WP_000672408.1.30752 WP_000672408.1.30909 WP_000672408.1.30968 WP_000672408.1.31107 WP_000672408.1.31111 WP_000672408.1.31167 WP_000672408.1.31210 WP_000672408.1.31222 WP_000672408.1.3124 WP_000672408.1.31272 WP_000672408.1.31335 WP_000672408.1.31435 WP_000672408.1.31476 WP_000672408.1.31585 WP_000672408.1.3167 WP_000672408.1.31762 WP_000672408.1.31895 WP_000672408.1.31901 WP_000672408.1.32109 WP_000672408.1.32116 WP_000672408.1.32252 WP_000672408.1.32274 WP_000672408.1.32277 WP_000672408.1.32309 WP_000672408.1.32423 WP_000672408.1.32519 WP_000672408.1.32668 WP_000672408.1.32740 WP_000672408.1.32747 WP_000672408.1.32832 WP_000672408.1.32881 WP_000672408.1.32899 WP_000672408.1.32977 WP_000672408.1.33078 WP_000672408.1.33253 WP_000672408.1.33270 WP_000672408.1.33409 WP_000672408.1.335 WP_000672408.1.3356 WP_000672408.1.33586 WP_000672408.1.33609 WP_000672408.1.33629 WP_000672408.1.3364 WP_000672408.1.3396 WP_000672408.1.34091 WP_000672408.1.34107 WP_000672408.1.34126 WP_000672408.1.34185 WP_000672408.1.34292 WP_000672408.1.3438 WP_000672408.1.34431 WP_000672408.1.34454 WP_000672408.1.34614 WP_000672408.1.34667 WP_000672408.1.34711 WP_000672408.1.3476 WP_000672408.1.34817 WP_000672408.1.34820 WP_000672408.1.35298 WP_000672408.1.35321 WP_000672408.1.35460 WP_000672408.1.35563 WP_000672408.1.35570 WP_000672408.1.35594 WP_000672408.1.35624 WP_000672408.1.35887 WP_000672408.1.35936 WP_000672408.1.36011 WP_000672408.1.36037 WP_000672408.1.36063 WP_000672408.1.36157 WP_000672408.1.36409 WP_000672408.1.36445 WP_000672408.1.36584 WP_000672408.1.36685 WP_000672408.1.36721 WP_000672408.1.36751 WP_000672408.1.36764 WP_000672408.1.36889 WP_000672408.1.36949 WP_000672408.1.37029 WP_000672408.1.37114 WP_000672408.1.37191 WP_000672408.1.37297 WP_000672408.1.37405 WP_000672408.1.3748 WP_000672408.1.37558 WP_000672408.1.37666 WP_000672408.1.3771 WP_000672408.1.3778 WP_000672408.1.37864 WP_000672408.1.3790 WP_000672408.1.38001 WP_000672408.1.38037 WP_000672408.1.38047 WP_000672408.1.38199 WP_000672408.1.38344 WP_000672408.1.38408 WP_000672408.1.39048 WP_000672408.1.39055 WP_000672408.1.39065 WP_000672408.1.39312 WP_000672408.1.39385 WP_000672408.1.39395 WP_000672408.1.39497 WP_000672408.1.40081 WP_000672408.1.40307 WP_000672408.1.40493 WP_000672408.1.40533 WP_000672408.1.40577 WP_000672408.1.40622 WP_000672408.1.40695 WP_000672408.1.40745 WP_000672408.1.40788 WP_000672408.1.40849 WP_000672408.1.40930 WP_000672408.1.40973 WP_000672408.1.41116 WP_000672408.1.41128 WP_000672408.1.41192 WP_000672408.1.41277 WP_000672408.1.41427 WP_000672408.1.41438 WP_000672408.1.41528 WP_000672408.1.41610 WP_000672408.1.41688 WP_000672408.1.41690 WP_000672408.1.41789 WP_000672408.1.41799 WP_000672408.1.41911 WP_000672408.1.41949 WP_000672408.1.41978 WP_000672408.1.41998 WP_000672408.1.42009 WP_000672408.1.42136 WP_000672408.1.422 WP_000672408.1.42263 WP_000672408.1.42322 WP_000672408.1.42392 WP_000672408.1.42666 WP_000672408.1.42675 WP_000672408.1.42683 WP_000672408.1.42734 WP_000672408.1.42797 WP_000672408.1.42829 WP_000672408.1.42887 WP_000672408.1.42892 WP_000672408.1.42932 WP_000672408.1.42957 WP_000672408.1.43086 WP_000672408.1.43160 WP_000672408.1.43201 WP_000672408.1.4344 WP_000672408.1.43476 WP_000672408.1.43535 WP_000672408.1.43685 WP_000672408.1.43711 WP_000672408.1.43785 WP_000672408.1.43875 WP_000672408.1.44010 WP_000672408.1.4405 WP_000672408.1.44250 WP_000672408.1.44337 WP_000672408.1.4440 WP_000672408.1.44438 WP_000672408.1.44440 WP_000672408.1.44474 WP_000672408.1.44578 WP_000672408.1.44705 WP_000672408.1.44831 WP_000672408.1.44887 WP_000672408.1.44966 WP_000672408.1.44978 WP_000672408.1.44997 WP_000672408.1.4500 WP_000672408.1.45173 WP_000672408.1.45302 WP_000672408.1.4531 WP_000672408.1.45432 WP_000672408.1.45549 WP_000672408.1.45569 WP_000672408.1.45571 WP_000672408.1.45583 WP_000672408.1.45706 WP_000672408.1.45844 WP_000672408.1.45906 WP_000672408.1.45918 WP_000672408.1.46028 WP_000672408.1.46091 WP_000672408.1.46215 WP_000672408.1.46232 WP_000672408.1.46250 WP_000672408.1.46286 WP_000672408.1.46322 WP_000672408.1.46574 WP_000672408.1.46578 WP_000672408.1.46666 WP_000672408.1.46726 WP_000672408.1.46730 WP_000672408.1.4674 WP_000672408.1.4686 WP_000672408.1.46961 WP_000672408.1.46967 WP_000672408.1.46976 WP_000672408.1.47507 WP_000672408.1.47567 WP_000672408.1.47576 WP_000672408.1.4758 WP_000672408.1.47649 WP_000672408.1.47714 WP_000672408.1.47814 WP_000672408.1.47829 WP_000672408.1.47850 WP_000672408.1.47875 WP_000672408.1.47902 WP_000672408.1.47911 WP_000672408.1.47988 WP_000672408.1.47992 WP_000672408.1.48209 WP_000672408.1.4839 WP_000672408.1.48570 WP_000672408.1.48755 WP_000672408.1.48797 WP_000672408.1.48886 WP_000672408.1.48985 WP_000672408.1.49102 WP_000672408.1.49175 WP_000672408.1.49226 WP_000672408.1.49233 WP_000672408.1.49304 WP_000672408.1.49311 WP_000672408.1.49334 WP_000672408.1.49472 WP_000672408.1.49626 WP_000672408.1.49770 WP_000672408.1.49931 WP_000672408.1.50007 WP_000672408.1.50128 WP_000672408.1.50332 WP_000672408.1.50449 WP_000672408.1.50469 WP_000672408.1.50563 WP_000672408.1.50652 WP_000672408.1.50684 WP_000672408.1.50882 WP_000672408.1.50960 WP_000672408.1.51117 WP_000672408.1.51131 WP_000672408.1.51162 WP_000672408.1.51356 WP_000672408.1.51412 WP_000672408.1.51414 WP_000672408.1.51451 WP_000672408.1.51502 WP_000672408.1.51611 WP_000672408.1.51642 WP_000672408.1.51764 WP_000672408.1.51810 WP_000672408.1.51868 WP_000672408.1.51930 WP_000672408.1.51994 WP_000672408.1.520 WP_000672408.1.5211 WP_000672408.1.52156 WP_000672408.1.52301 WP_000672408.1.52321 WP_000672408.1.52438 WP_000672408.1.52582 WP_000672408.1.52586 WP_000672408.1.52833 WP_000672408.1.53107 WP_000672408.1.53119 WP_000672408.1.5313 WP_000672408.1.53198 WP_000672408.1.53206 WP_000672408.1.53234 WP_000672408.1.53362 WP_000672408.1.53385 WP_000672408.1.53567 WP_000672408.1.53664 WP_000672408.1.53694 WP_000672408.1.53772 WP_000672408.1.53778 WP_000672408.1.53781 WP_000672408.1.53896 WP_000672408.1.53935 WP_000672408.1.53961 WP_000672408.1.54061 WP_000672408.1.54082 WP_000672408.1.54283 WP_000672408.1.54366 WP_000672408.1.54569 WP_000672408.1.54615 WP_000672408.1.54774 WP_000672408.1.54833 WP_000672408.1.5485 WP_000672408.1.54877 WP_000672408.1.54936 WP_000672408.1.5517 WP_000672408.1.55294 WP_000672408.1.55559 WP_000672408.1.55623 WP_000672408.1.55640 WP_000672408.1.55706 WP_000672408.1.5572 WP_000672408.1.5577 WP_000672408.1.55948 WP_000672408.1.56097 WP_000672408.1.56235 WP_000672408.1.56247 WP_000672408.1.56263 WP_000672408.1.56303 WP_000672408.1.56370 WP_000672408.1.56389 WP_000672408.1.56393 WP_000672408.1.5668 WP_000672408.1.56851 WP_000672408.1.56853 WP_000672408.1.56861 WP_000672408.1.56893 WP_000672408.1.56898 WP_000672408.1.57026 WP_000672408.1.57039 WP_000672408.1.57056 WP_000672408.1.5711 WP_000672408.1.57125 WP_000672408.1.57143 WP_000672408.1.57149 WP_000672408.1.57246 WP_000672408.1.57296 WP_000672408.1.57307 WP_000672408.1.57357 WP_000672408.1.57362 WP_000672408.1.57559 WP_000672408.1.57631 WP_000672408.1.57641 WP_000672408.1.57735 WP_000672408.1.57797 WP_000672408.1.57835 WP_000672408.1.57893 WP_000672408.1.58040 WP_000672408.1.58090 WP_000672408.1.58249 WP_000672408.1.5828 WP_000672408.1.58290 WP_000672408.1.58301 WP_000672408.1.58443 WP_000672408.1.58486 WP_000672408.1.58489 WP_000672408.1.58564 WP_000672408.1.58604 WP_000672408.1.58675 WP_000672408.1.58698 WP_000672408.1.587 WP_000672408.1.58861 WP_000672408.1.58884 WP_000672408.1.58926 WP_000672408.1.58932 WP_000672408.1.59125 WP_000672408.1.59142 WP_000672408.1.59163 WP_000672408.1.59336 WP_000672408.1.59381 WP_000672408.1.59427 WP_000672408.1.59538 WP_000672408.1.59548 WP_000672408.1.59641 WP_000672408.1.59646 WP_000672408.1.59830 WP_000672408.1.59848 WP_000672408.1.59928 WP_000672408.1.60004 WP_000672408.1.60126 WP_000672408.1.60137 WP_000672408.1.60226 WP_000672408.1.6033 WP_000672408.1.60425 WP_000672408.1.60560 WP_000672408.1.60597 WP_000672408.1.60713 WP_000672408.1.60746 WP_000672408.1.608 WP_000672408.1.60838 WP_000672408.1.60866 WP_000672408.1.60897 WP_000672408.1.60919 WP_000672408.1.61218 WP_000672408.1.61233 WP_000672408.1.61356 WP_000672408.1.61381 WP_000672408.1.61501 WP_000672408.1.61594 WP_000672408.1.61595 WP_000672408.1.6164 WP_000672408.1.61671 WP_000672408.1.61783 WP_000672408.1.61908 WP_000672408.1.61922 WP_000672408.1.6210 WP_000672408.1.62158 WP_000672408.1.62201 WP_000672408.1.62210 WP_000672408.1.62219 WP_000672408.1.62241 WP_000672408.1.62412 WP_000672408.1.62486 WP_000672408.1.62564 WP_000672408.1.627 WP_000672408.1.62745 WP_000672408.1.62757 WP_000672408.1.62798 WP_000672408.1.6292 WP_000672408.1.62983 WP_000672408.1.62988 WP_000672408.1.63043 WP_000672408.1.63045 WP_000672408.1.63102 WP_000672408.1.63118 WP_000672408.1.63135 WP_000672408.1.63229 WP_000672408.1.63234 WP_000672408.1.63250 WP_000672408.1.63358 WP_000672408.1.63422 WP_000672408.1.63497 WP_000672408.1.63509 WP_000672408.1.63529 WP_000672408.1.63532 WP_000672408.1.63568 WP_000672408.1.63585 WP_000672408.1.63603 WP_000672408.1.6370 WP_000672408.1.63748 WP_000672408.1.63824 WP_000672408.1.63851 WP_000672408.1.63863 WP_000672408.1.63992 WP_000672408.1.64007 WP_000672408.1.64010 WP_000672408.1.64085 WP_000672408.1.64109 WP_000672408.1.64157 WP_000672408.1.64229 WP_000672408.1.64242 WP_000672408.1.64350 WP_000672408.1.64374 WP_000672408.1.64385 WP_000672408.1.64462 WP_000672408.1.64500 WP_000672408.1.64597 WP_000672408.1.64711 WP_000672408.1.64977 WP_000672408.1.65011 WP_000672408.1.65016 WP_000672408.1.65027 WP_000672408.1.65357 WP_000672408.1.65601 WP_000672408.1.65698 WP_000672408.1.65771 WP_000672408.1.65838 WP_000672408.1.65881 WP_000672408.1.65883 WP_000672408.1.65901 WP_000672408.1.6595 WP_000672408.1.66167 WP_000672408.1.66171 WP_000672408.1.66315 WP_000672408.1.66385 WP_000672408.1.66400 WP_000672408.1.66428 WP_000672408.1.66446 WP_000672408.1.66492 WP_000672408.1.66534 WP_000672408.1.66539 WP_000672408.1.66630 WP_000672408.1.66733 WP_000672408.1.66807 WP_000672408.1.66820 WP_000672408.1.66876 WP_000672408.1.6692 WP_000672408.1.66959 WP_000672408.1.67075 WP_000672408.1.6710 WP_000672408.1.67173 WP_000672408.1.67184 WP_000672408.1.67279 WP_000672408.1.67288 WP_000672408.1.67374 WP_000672408.1.6760 WP_000672408.1.6782 WP_000672408.1.67905 WP_000672408.1.67932 WP_000672408.1.67977 WP_000672408.1.68036 WP_000672408.1.68140 WP_000672408.1.68159 WP_000672408.1.68210 WP_000672408.1.6833 WP_000672408.1.68532 WP_000672408.1.68652 WP_000672408.1.68677 WP_000672408.1.68818 WP_000672408.1.68893 WP_000672408.1.68895 WP_000672408.1.69080 WP_000672408.1.69086 WP_000672408.1.69131 WP_000672408.1.69236 WP_000672408.1.69273 WP_000672408.1.69288 WP_000672408.1.69296 WP_000672408.1.69485 WP_000672408.1.69515 WP_000672408.1.69575 WP_000672408.1.69616 WP_000672408.1.69636 WP_000672408.1.69767 WP_000672408.1.69890 WP_000672408.1.69965 WP_000672408.1.70088 WP_000672408.1.7010 WP_000672408.1.7014 WP_000672408.1.7016 WP_000672408.1.70248 WP_000672408.1.70272 WP_000672408.1.70321 WP_000672408.1.70326 WP_000672408.1.70440 WP_000672408.1.70523 WP_000672408.1.70531 WP_000672408.1.70547 WP_000672408.1.70596 WP_000672408.1.70678 WP_000672408.1.70732 WP_000672408.1.70785 WP_000672408.1.70837 WP_000672408.1.70914 WP_000672408.1.70985 WP_000672408.1.7110 WP_000672408.1.71171 WP_000672408.1.71172 WP_000672408.1.71184 WP_000672408.1.71201 WP_000672408.1.71305 WP_000672408.1.71446 WP_000672408.1.71626 WP_000672408.1.71649 WP_000672408.1.7174 WP_000672408.1.71756 WP_000672408.1.71979 WP_000672408.1.71984 WP_000672408.1.720 WP_000672408.1.72068 WP_000672408.1.72100 WP_000672408.1.72190 WP_000672408.1.72221 WP_000672408.1.72226 WP_000672408.1.72300 WP_000672408.1.72325 WP_000672408.1.72339 WP_000672408.1.72532 WP_000672408.1.72602 WP_000672408.1.72689 WP_000672408.1.72716 WP_000672408.1.72718 WP_000672408.1.72850 WP_000672408.1.72865 WP_000672408.1.72872 WP_000672408.1.7295 WP_000672408.1.73068 WP_000672408.1.73144 WP_000672408.1.73708 WP_000672408.1.73831 WP_000672408.1.74174 WP_000672408.1.74207 WP_000672408.1.74248 WP_000672408.1.743 WP_000672408.1.74300 WP_000672408.1.74402 WP_000672408.1.7444 WP_000672408.1.74578 WP_000672408.1.74884 WP_000672408.1.74972 WP_000672408.1.74996 WP_000672408.1.75051 WP_000672408.1.75056 WP_000672408.1.75148 WP_000672408.1.75159 WP_000672408.1.75400 WP_000672408.1.75402 WP_000672408.1.75450 WP_000672408.1.7558 WP_000672408.1.75607 WP_000672408.1.75703 WP_000672408.1.75716 WP_000672408.1.75751 WP_000672408.1.75793 WP_000672408.1.75794 WP_000672408.1.75810 WP_000672408.1.75863 WP_000672408.1.75873 WP_000672408.1.75902 WP_000672408.1.75932 WP_000672408.1.76097 WP_000672408.1.76108 WP_000672408.1.76137 WP_000672408.1.76208 WP_000672408.1.76345 WP_000672408.1.76364 WP_000672408.1.76434 WP_000672408.1.76451 WP_000672408.1.76495 WP_000672408.1.76738 WP_000672408.1.76776 WP_000672408.1.76806 WP_000672408.1.76913 WP_000672408.1.76968 WP_000672408.1.77306 WP_000672408.1.77356 WP_000672408.1.77475 WP_000672408.1.77496 WP_000672408.1.77543 WP_000672408.1.77565 WP_000672408.1.7792 WP_000672408.1.7793 WP_000672408.1.77951 WP_000672408.1.77971 WP_000672408.1.77983 WP_000672408.1.77989 WP_000672408.1.7802 WP_000672408.1.78051 WP_000672408.1.78170 WP_000672408.1.78201 WP_000672408.1.78443 WP_000672408.1.78495 WP_000672408.1.78496 WP_000672408.1.78501 WP_000672408.1.78602 WP_000672408.1.78603 WP_000672408.1.78632 WP_000672408.1.78658 WP_000672408.1.78697 WP_000672408.1.78734 WP_000672408.1.7877 WP_000672408.1.78815 WP_000672408.1.78877 WP_000672408.1.78896 WP_000672408.1.79099 WP_000672408.1.79289 WP_000672408.1.79297 WP_000672408.1.79468 WP_000672408.1.79580 WP_000672408.1.79586 WP_000672408.1.7979 WP_000672408.1.7982 WP_000672408.1.7991 WP_000672408.1.80249 WP_000672408.1.80250 WP_000672408.1.80254 WP_000672408.1.80380 WP_000672408.1.80529 WP_000672408.1.80586 WP_000672408.1.80725 WP_000672408.1.80760 WP_000672408.1.80857 WP_000672408.1.80874 WP_000672408.1.80876 WP_000672408.1.80959 WP_000672408.1.8106 WP_000672408.1.81107 WP_000672408.1.81109 WP_000672408.1.81110 WP_000672408.1.81197 WP_000672408.1.81225 WP_000672408.1.81275 WP_000672408.1.8130 WP_000672408.1.81302 WP_000672408.1.8134 WP_000672408.1.81388 WP_000672408.1.81667 WP_000672408.1.81668 WP_000672408.1.81768 WP_000672408.1.82149 WP_000672408.1.82401 WP_000672408.1.82420 WP_000672408.1.82434 WP_000672408.1.8247 WP_000672408.1.82569 WP_000672408.1.82570 WP_000672408.1.82648 WP_000672408.1.82841 WP_000672408.1.82895 WP_000672408.1.82908 WP_000672408.1.82937 WP_000672408.1.83005 WP_000672408.1.83006 WP_000672408.1.83061 WP_000672408.1.83204 WP_000672408.1.83331 WP_000672408.1.83354 WP_000672408.1.83356 WP_000672408.1.83558 WP_000672408.1.83650 WP_000672408.1.83739 WP_000672408.1.83759 WP_000672408.1.83854 WP_000672408.1.83979 WP_000672408.1.8399 WP_000672408.1.84000 WP_000672408.1.84011 WP_000672408.1.84075 WP_000672408.1.84083 WP_000672408.1.84086 WP_000672408.1.84154 WP_000672408.1.84300 WP_000672408.1.84355 WP_000672408.1.84497 WP_000672408.1.84515 WP_000672408.1.84572 WP_000672408.1.84598 WP_000672408.1.84876 WP_000672408.1.84983 WP_000672408.1.85079 WP_000672408.1.85120 WP_000672408.1.85126 WP_000672408.1.8526 WP_000672408.1.85271 WP_000672408.1.85301 WP_000672408.1.8552 WP_000672408.1.85723 WP_000672408.1.85759 WP_000672408.1.85982 WP_000672408.1.86010 WP_000672408.1.86138 WP_000672408.1.86157 WP_000672408.1.8616 WP_000672408.1.86316 WP_000672408.1.86347 WP_000672408.1.86380 WP_000672408.1.86453 WP_000672408.1.8647 WP_000672408.1.86514 WP_000672408.1.86915 WP_000672408.1.86982 WP_000672408.1.87038 WP_000672408.1.87143 WP_000672408.1.87187 WP_000672408.1.87265 WP_000672408.1.87283 WP_000672408.1.87484 WP_000672408.1.87493 WP_000672408.1.87500 WP_000672408.1.87583 WP_000672408.1.87712 WP_000672408.1.87875 WP_000672408.1.87905 WP_000672408.1.88014 WP_000672408.1.88052 WP_000672408.1.88185 WP_000672408.1.88275 WP_000672408.1.88303 WP_000672408.1.88356 WP_000672408.1.88474 WP_000672408.1.88508 WP_000672408.1.88624 WP_000672408.1.88731 WP_000672408.1.88854 WP_000672408.1.88966 WP_000672408.1.88968 WP_000672408.1.88998 WP_000672408.1.89120 WP_000672408.1.89177 WP_000672408.1.89221 WP_000672408.1.89362 WP_000672408.1.89408 WP_000672408.1.89425 WP_000672408.1.89606 WP_000672408.1.8961 WP_000672408.1.89634 WP_000672408.1.89680 WP_000672408.1.89815 WP_000672408.1.89832 WP_000672408.1.9003 WP_000672408.1.90193 WP_000672408.1.90248 WP_000672408.1.90348 WP_000672408.1.90421 WP_000672408.1.90522 WP_000672408.1.90540 WP_000672408.1.90563 WP_000672408.1.90701 WP_000672408.1.90748 WP_000672408.1.90759 WP_000672408.1.90859 WP_000672408.1.90866 WP_000672408.1.90959 WP_000672408.1.90973 WP_000672408.1.91215 WP_000672408.1.9137 WP_000672408.1.91372 WP_000672408.1.91424 WP_000672408.1.91470 WP_000672408.1.91474 WP_000672408.1.91505 WP_000672408.1.91742 WP_000672408.1.91772 WP_000672408.1.91776 WP_000672408.1.91795 WP_000672408.1.91898 WP_000672408.1.91903 WP_000672408.1.91904 WP_000672408.1.91974 WP_000672408.1.92047 WP_000672408.1.92067 WP_000672408.1.92082 WP_000672408.1.92129 WP_000672408.1.9222 WP_000672408.1.92439 WP_000672408.1.92452 WP_000672408.1.92529 WP_000672408.1.92557 WP_000672408.1.92562 WP_000672408.1.92628 WP_000672408.1.92729 WP_000672408.1.92806 WP_000672408.1.92890 WP_000672408.1.92929 WP_000672408.1.92975 WP_000672408.1.93076 WP_000672408.1.93215 WP_000672408.1.93350 WP_000672408.1.93524 WP_000672408.1.93577 WP_000672408.1.93596 WP_000672408.1.93761 WP_000672408.1.9380 WP_000672408.1.93803 WP_000672408.1.93809 WP_000672408.1.94181 WP_000672408.1.9440 WP_000672408.1.94473 WP_000672408.1.94598 WP_000672408.1.94649 WP_000672408.1.94669 WP_000672408.1.94670 WP_000672408.1.94785 WP_000672408.1.94817 WP_000672408.1.94835 WP_000672408.1.95136 WP_000672408.1.9516 WP_000672408.1.9527 WP_000672408.1.95434 WP_000672408.1.95447 WP_000672408.1.95456 WP_000672408.1.95579 WP_000672408.1.95607 WP_000672408.1.95656 WP_000672408.1.95757 WP_000672408.1.9586 WP_000672408.1.95866 WP_000672408.1.95963 WP_000672408.1.96107 WP_000672408.1.96206 WP_000672408.1.9624 WP_000672408.1.96335 WP_000672408.1.96340 WP_000672408.1.96348 WP_000672408.1.96349 WP_000672408.1.96380 WP_000672408.1.96521 WP_000672408.1.96537 WP_000672408.1.96588 WP_000672408.1.96600 WP_000672408.1.96735 WP_000672408.1.96798 WP_000672408.1.96876 WP_000672408.1.96993 WP_000672408.1.97103 WP_000672408.1.97224 WP_000672408.1.97322 WP_000672408.1.97328 WP_000672408.1.97547 WP_000672408.1.97648 WP_000672408.1.97656 WP_000672408.1.97691 WP_000672408.1.97704 WP_000672408.1.9774 WP_000672408.1.97800 WP_000672408.1.97907 WP_000672408.1.9793 WP_000672408.1.97981 WP_000672408.1.97991 WP_000672408.1.98119 WP_000672408.1.98338 WP_000672408.1.98440 WP_000672408.1.98472 WP_000672408.1.98513 WP_000672408.1.98570 WP_000672408.1.98726 WP_000672408.1.98779 WP_000672408.1.98899 WP_000672408.1.9899 WP_000672408.1.99057 WP_000672408.1.99097 WP_000672408.1.99164 WP_000672408.1.99215 WP_000672408.1.99456 WP_000672408.1.99490 WP_000672408.1.99493 WP_000672408.1.99613 WP_000672408.1.99630 WP_000672408.1.99725 WP_000672408.1.99924 WP_000672408.1.99961 gi|205352939|ref|YP_002226740.1| gi|525947492|ref|YP_008308885.1| 272994.SPAB_01999 423368.SNSL254_A1449 550537.SEN1706 550538.SG1779 ABAN01000011|CDS_148633-146246 AM933172|CDS_1812672-1810285 AM933173|CDS_1852473-1850086 CP000886|CDS_1705559-1703172 CP001113|CDS_1416091-1418478 gi|207857155|ref|YP_002243806.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]