SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|207859449|ref|YP_002246100.1| from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|207859449|ref|YP_002246100.1|
Domain Number 1 Region: 197-248
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000136
Family AraC type transcriptional activator 0.046
Further Details:      
 
Weak hits

Sequence:  gi|207859449|ref|YP_002246100.1|
Domain Number - Region: 17-91
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0288
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|207859449|ref|YP_002246100.1|
Sequence length 253
Comment AraC family regulatory protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
Sequence
MRICSNEPCIVLLTEKDTWLRVNGKEPISLKANHMAILACENNVIDISSLNSVLVIQVSR
NNIKDYLQFLNKDLSHLPVWQRNADPLLTANCLTPDIFRVAARYSAMEAPDEIVSERTRA
LLFTVLSRFLDHKKFISLLMHMLRSRISDSVYHIIQSDIHKDWNLSAVASCLCLSPSLLK
KKLKNENTSYSQIITTCRMRYAVNQLLMDGKNISQVSQLCGYNSTSYFISVFKEFYGMTP
LHYVSQHRERSAA
Download sequence
Identical sequences A0A0F6BAF4 A0A0H3NIW6 A0A0M0QPS2 A0A0T9W0T2 A0A0T9WRX0 A0A1R2KFB3 A0A265B2A7 A0A2C6ZU19 A0A2H9YDS6 A0A2J5WVA4 A0A2K2Z0R5 E8X9U6 Q8ZKE4 V1WM06
gi|482906833|ref|YP_007905393.1| NP_463160.1.58477 WP_001217074.1.100017 WP_001217074.1.100077 WP_001217074.1.100149 WP_001217074.1.100191 WP_001217074.1.100234 WP_001217074.1.100288 WP_001217074.1.100376 WP_001217074.1.100392 WP_001217074.1.100412 WP_001217074.1.100424 WP_001217074.1.100432 WP_001217074.1.100436 WP_001217074.1.100457 WP_001217074.1.100484 WP_001217074.1.100488 WP_001217074.1.100519 WP_001217074.1.100521 WP_001217074.1.100557 WP_001217074.1.100584 WP_001217074.1.100605 WP_001217074.1.100650 WP_001217074.1.100730 WP_001217074.1.100750 WP_001217074.1.100776 WP_001217074.1.100793 WP_001217074.1.10081 WP_001217074.1.100857 WP_001217074.1.100871 WP_001217074.1.100895 WP_001217074.1.101007 WP_001217074.1.101074 WP_001217074.1.101112 WP_001217074.1.101126 WP_001217074.1.101180 WP_001217074.1.101185 WP_001217074.1.101223 WP_001217074.1.101259 WP_001217074.1.101284 WP_001217074.1.101291 WP_001217074.1.1013 WP_001217074.1.101353 WP_001217074.1.101404 WP_001217074.1.101420 WP_001217074.1.101454 WP_001217074.1.101589 WP_001217074.1.101612 WP_001217074.1.101634 WP_001217074.1.101636 WP_001217074.1.101674 WP_001217074.1.101741 WP_001217074.1.101832 WP_001217074.1.101841 WP_001217074.1.101868 WP_001217074.1.10191 WP_001217074.1.101917 WP_001217074.1.101927 WP_001217074.1.101953 WP_001217074.1.101975 WP_001217074.1.102111 WP_001217074.1.10220 WP_001217074.1.10231 WP_001217074.1.10266 WP_001217074.1.10300 WP_001217074.1.10439 WP_001217074.1.10498 WP_001217074.1.10521 WP_001217074.1.10566 WP_001217074.1.10568 WP_001217074.1.10631 WP_001217074.1.10711 WP_001217074.1.10720 WP_001217074.1.10753 WP_001217074.1.10755 WP_001217074.1.10868 WP_001217074.1.10898 WP_001217074.1.10992 WP_001217074.1.11031 WP_001217074.1.11098 WP_001217074.1.1110 WP_001217074.1.11119 WP_001217074.1.11156 WP_001217074.1.11216 WP_001217074.1.11254 WP_001217074.1.11295 WP_001217074.1.11304 WP_001217074.1.11362 WP_001217074.1.11458 WP_001217074.1.1150 WP_001217074.1.11518 WP_001217074.1.11526 WP_001217074.1.11528 WP_001217074.1.11532 WP_001217074.1.11543 WP_001217074.1.1156 WP_001217074.1.11565 WP_001217074.1.11588 WP_001217074.1.11677 WP_001217074.1.11687 WP_001217074.1.1169 WP_001217074.1.11735 WP_001217074.1.1174 WP_001217074.1.11763 WP_001217074.1.11772 WP_001217074.1.11824 WP_001217074.1.11834 WP_001217074.1.11841 WP_001217074.1.11875 WP_001217074.1.11900 WP_001217074.1.11964 WP_001217074.1.11978 WP_001217074.1.12017 WP_001217074.1.12027 WP_001217074.1.12106 WP_001217074.1.12114 WP_001217074.1.1215 WP_001217074.1.12168 WP_001217074.1.12280 WP_001217074.1.12340 WP_001217074.1.12351 WP_001217074.1.12374 WP_001217074.1.1239 WP_001217074.1.12397 WP_001217074.1.12485 WP_001217074.1.12546 WP_001217074.1.12568 WP_001217074.1.12569 WP_001217074.1.12585 WP_001217074.1.12696 WP_001217074.1.12701 WP_001217074.1.12718 WP_001217074.1.12879 WP_001217074.1.12936 WP_001217074.1.12995 WP_001217074.1.1300 WP_001217074.1.13027 WP_001217074.1.13076 WP_001217074.1.13101 WP_001217074.1.13102 WP_001217074.1.13106 WP_001217074.1.13207 WP_001217074.1.13247 WP_001217074.1.13274 WP_001217074.1.13367 WP_001217074.1.13391 WP_001217074.1.13429 WP_001217074.1.13446 WP_001217074.1.1346 WP_001217074.1.13488 WP_001217074.1.13509 WP_001217074.1.13528 WP_001217074.1.13573 WP_001217074.1.13625 WP_001217074.1.13661 WP_001217074.1.1387 WP_001217074.1.13908 WP_001217074.1.13932 WP_001217074.1.13968 WP_001217074.1.14001 WP_001217074.1.14050 WP_001217074.1.14056 WP_001217074.1.14111 WP_001217074.1.1412 WP_001217074.1.14151 WP_001217074.1.14212 WP_001217074.1.14239 WP_001217074.1.14320 WP_001217074.1.14379 WP_001217074.1.14410 WP_001217074.1.14436 WP_001217074.1.14458 WP_001217074.1.14505 WP_001217074.1.14524 WP_001217074.1.14554 WP_001217074.1.146 WP_001217074.1.14618 WP_001217074.1.14708 WP_001217074.1.14725 WP_001217074.1.14789 WP_001217074.1.14793 WP_001217074.1.14819 WP_001217074.1.14852 WP_001217074.1.14876 WP_001217074.1.1489 WP_001217074.1.14913 WP_001217074.1.14927 WP_001217074.1.14932 WP_001217074.1.14936 WP_001217074.1.15046 WP_001217074.1.15055 WP_001217074.1.15067 WP_001217074.1.15102 WP_001217074.1.15214 WP_001217074.1.15223 WP_001217074.1.15226 WP_001217074.1.15276 WP_001217074.1.15316 WP_001217074.1.15318 WP_001217074.1.15369 WP_001217074.1.1540 WP_001217074.1.15508 WP_001217074.1.15585 WP_001217074.1.15612 WP_001217074.1.15627 WP_001217074.1.1568 WP_001217074.1.15775 WP_001217074.1.15777 WP_001217074.1.15784 WP_001217074.1.15835 WP_001217074.1.15862 WP_001217074.1.15910 WP_001217074.1.15986 WP_001217074.1.15995 WP_001217074.1.16004 WP_001217074.1.16028 WP_001217074.1.16047 WP_001217074.1.16103 WP_001217074.1.16172 WP_001217074.1.16233 WP_001217074.1.16244 WP_001217074.1.16284 WP_001217074.1.1635 WP_001217074.1.16361 WP_001217074.1.16363 WP_001217074.1.16365 WP_001217074.1.16366 WP_001217074.1.16394 WP_001217074.1.16453 WP_001217074.1.16468 WP_001217074.1.16474 WP_001217074.1.16525 WP_001217074.1.16551 WP_001217074.1.16650 WP_001217074.1.16686 WP_001217074.1.16691 WP_001217074.1.16729 WP_001217074.1.16735 WP_001217074.1.16786 WP_001217074.1.16858 WP_001217074.1.16873 WP_001217074.1.1689 WP_001217074.1.16896 WP_001217074.1.16903 WP_001217074.1.16942 WP_001217074.1.16944 WP_001217074.1.16949 WP_001217074.1.16965 WP_001217074.1.16972 WP_001217074.1.17060 WP_001217074.1.17093 WP_001217074.1.17096 WP_001217074.1.17105 WP_001217074.1.17307 WP_001217074.1.1733 WP_001217074.1.1737 WP_001217074.1.174 WP_001217074.1.17480 WP_001217074.1.17482 WP_001217074.1.17525 WP_001217074.1.17546 WP_001217074.1.1757 WP_001217074.1.17583 WP_001217074.1.17693 WP_001217074.1.17702 WP_001217074.1.17705 WP_001217074.1.17732 WP_001217074.1.17743 WP_001217074.1.17755 WP_001217074.1.17886 WP_001217074.1.17891 WP_001217074.1.17914 WP_001217074.1.17936 WP_001217074.1.1798 WP_001217074.1.18019 WP_001217074.1.18056 WP_001217074.1.18061 WP_001217074.1.18092 WP_001217074.1.18109 WP_001217074.1.18122 WP_001217074.1.18149 WP_001217074.1.18163 WP_001217074.1.18178 WP_001217074.1.1818 WP_001217074.1.1825 WP_001217074.1.18254 WP_001217074.1.18265 WP_001217074.1.18384 WP_001217074.1.18607 WP_001217074.1.18641 WP_001217074.1.18686 WP_001217074.1.18705 WP_001217074.1.18715 WP_001217074.1.18737 WP_001217074.1.18776 WP_001217074.1.18847 WP_001217074.1.18886 WP_001217074.1.18949 WP_001217074.1.1895 WP_001217074.1.19093 WP_001217074.1.19273 WP_001217074.1.19373 WP_001217074.1.19433 WP_001217074.1.19458 WP_001217074.1.19460 WP_001217074.1.19461 WP_001217074.1.1955 WP_001217074.1.19588 WP_001217074.1.19614 WP_001217074.1.19616 WP_001217074.1.19656 WP_001217074.1.1968 WP_001217074.1.19702 WP_001217074.1.19706 WP_001217074.1.19724 WP_001217074.1.19740 WP_001217074.1.19749 WP_001217074.1.19784 WP_001217074.1.19793 WP_001217074.1.19802 WP_001217074.1.19834 WP_001217074.1.19851 WP_001217074.1.19967 WP_001217074.1.19975 WP_001217074.1.20086 WP_001217074.1.20089 WP_001217074.1.2010 WP_001217074.1.20119 WP_001217074.1.20261 WP_001217074.1.20266 WP_001217074.1.20271 WP_001217074.1.2036 WP_001217074.1.2041 WP_001217074.1.20415 WP_001217074.1.20437 WP_001217074.1.20443 WP_001217074.1.20446 WP_001217074.1.20488 WP_001217074.1.20503 WP_001217074.1.2054 WP_001217074.1.20553 WP_001217074.1.20614 WP_001217074.1.20626 WP_001217074.1.20646 WP_001217074.1.20767 WP_001217074.1.20789 WP_001217074.1.20862 WP_001217074.1.20886 WP_001217074.1.20894 WP_001217074.1.20900 WP_001217074.1.21049 WP_001217074.1.21079 WP_001217074.1.21103 WP_001217074.1.21136 WP_001217074.1.2116 WP_001217074.1.21194 WP_001217074.1.21202 WP_001217074.1.21241 WP_001217074.1.21245 WP_001217074.1.21269 WP_001217074.1.21332 WP_001217074.1.21351 WP_001217074.1.21400 WP_001217074.1.21404 WP_001217074.1.2146 WP_001217074.1.21497 WP_001217074.1.21499 WP_001217074.1.21603 WP_001217074.1.21616 WP_001217074.1.21681 WP_001217074.1.21715 WP_001217074.1.21825 WP_001217074.1.21845 WP_001217074.1.21909 WP_001217074.1.21950 WP_001217074.1.21991 WP_001217074.1.22019 WP_001217074.1.22024 WP_001217074.1.22051 WP_001217074.1.22062 WP_001217074.1.22067 WP_001217074.1.22096 WP_001217074.1.22117 WP_001217074.1.22136 WP_001217074.1.22158 WP_001217074.1.22162 WP_001217074.1.2221 WP_001217074.1.22235 WP_001217074.1.22296 WP_001217074.1.22346 WP_001217074.1.2235 WP_001217074.1.22379 WP_001217074.1.22449 WP_001217074.1.22454 WP_001217074.1.22460 WP_001217074.1.22485 WP_001217074.1.22575 WP_001217074.1.22590 WP_001217074.1.22595 WP_001217074.1.22605 WP_001217074.1.22692 WP_001217074.1.22758 WP_001217074.1.22760 WP_001217074.1.22857 WP_001217074.1.22864 WP_001217074.1.22880 WP_001217074.1.22902 WP_001217074.1.22947 WP_001217074.1.23114 WP_001217074.1.2314 WP_001217074.1.23192 WP_001217074.1.2324 WP_001217074.1.23309 WP_001217074.1.23329 WP_001217074.1.23379 WP_001217074.1.23442 WP_001217074.1.23460 WP_001217074.1.23503 WP_001217074.1.23509 WP_001217074.1.23513 WP_001217074.1.2358 WP_001217074.1.23621 WP_001217074.1.23631 WP_001217074.1.23634 WP_001217074.1.2364 WP_001217074.1.23646 WP_001217074.1.23670 WP_001217074.1.23746 WP_001217074.1.23755 WP_001217074.1.23932 WP_001217074.1.23959 WP_001217074.1.24082 WP_001217074.1.24145 WP_001217074.1.24214 WP_001217074.1.24250 WP_001217074.1.24259 WP_001217074.1.24297 WP_001217074.1.24308 WP_001217074.1.24361 WP_001217074.1.24408 WP_001217074.1.24409 WP_001217074.1.24444 WP_001217074.1.24476 WP_001217074.1.24494 WP_001217074.1.24578 WP_001217074.1.24673 WP_001217074.1.24779 WP_001217074.1.24803 WP_001217074.1.24901 WP_001217074.1.24944 WP_001217074.1.24995 WP_001217074.1.25008 WP_001217074.1.25036 WP_001217074.1.25072 WP_001217074.1.25119 WP_001217074.1.25159 WP_001217074.1.25175 WP_001217074.1.2525 WP_001217074.1.25354 WP_001217074.1.25405 WP_001217074.1.25421 WP_001217074.1.25454 WP_001217074.1.25564 WP_001217074.1.25618 WP_001217074.1.25668 WP_001217074.1.2568 WP_001217074.1.25690 WP_001217074.1.2570 WP_001217074.1.25709 WP_001217074.1.25740 WP_001217074.1.25780 WP_001217074.1.25793 WP_001217074.1.25814 WP_001217074.1.25928 WP_001217074.1.25951 WP_001217074.1.25988 WP_001217074.1.26083 WP_001217074.1.26123 WP_001217074.1.26194 WP_001217074.1.26311 WP_001217074.1.26319 WP_001217074.1.26429 WP_001217074.1.26440 WP_001217074.1.26441 WP_001217074.1.26493 WP_001217074.1.26532 WP_001217074.1.26551 WP_001217074.1.26567 WP_001217074.1.26587 WP_001217074.1.26687 WP_001217074.1.2672 WP_001217074.1.26741 WP_001217074.1.26794 WP_001217074.1.26856 WP_001217074.1.26882 WP_001217074.1.26919 WP_001217074.1.26936 WP_001217074.1.26980 WP_001217074.1.27010 WP_001217074.1.27072 WP_001217074.1.27084 WP_001217074.1.27173 WP_001217074.1.27206 WP_001217074.1.27223 WP_001217074.1.27255 WP_001217074.1.27272 WP_001217074.1.27314 WP_001217074.1.27383 WP_001217074.1.27523 WP_001217074.1.27544 WP_001217074.1.27547 WP_001217074.1.27561 WP_001217074.1.2763 WP_001217074.1.27632 WP_001217074.1.27638 WP_001217074.1.27658 WP_001217074.1.27713 WP_001217074.1.27755 WP_001217074.1.27761 WP_001217074.1.2777 WP_001217074.1.27800 WP_001217074.1.27815 WP_001217074.1.27833 WP_001217074.1.27883 WP_001217074.1.27977 WP_001217074.1.27995 WP_001217074.1.28037 WP_001217074.1.28056 WP_001217074.1.28094 WP_001217074.1.28139 WP_001217074.1.28170 WP_001217074.1.28200 WP_001217074.1.28232 WP_001217074.1.28233 WP_001217074.1.28235 WP_001217074.1.28301 WP_001217074.1.28303 WP_001217074.1.2835 WP_001217074.1.28462 WP_001217074.1.2853 WP_001217074.1.28570 WP_001217074.1.28575 WP_001217074.1.28620 WP_001217074.1.28625 WP_001217074.1.28655 WP_001217074.1.28694 WP_001217074.1.28773 WP_001217074.1.2879 WP_001217074.1.2890 WP_001217074.1.28938 WP_001217074.1.28946 WP_001217074.1.28948 WP_001217074.1.29010 WP_001217074.1.29099 WP_001217074.1.2910 WP_001217074.1.29113 WP_001217074.1.29130 WP_001217074.1.29168 WP_001217074.1.29218 WP_001217074.1.2924 WP_001217074.1.29255 WP_001217074.1.29274 WP_001217074.1.2932 WP_001217074.1.29349 WP_001217074.1.29379 WP_001217074.1.29422 WP_001217074.1.29436 WP_001217074.1.29454 WP_001217074.1.29509 WP_001217074.1.29606 WP_001217074.1.29615 WP_001217074.1.29619 WP_001217074.1.29711 WP_001217074.1.29774 WP_001217074.1.29775 WP_001217074.1.29827 WP_001217074.1.2984 WP_001217074.1.29845 WP_001217074.1.29969 WP_001217074.1.29990 WP_001217074.1.30018 WP_001217074.1.30022 WP_001217074.1.30027 WP_001217074.1.3005 WP_001217074.1.30059 WP_001217074.1.30165 WP_001217074.1.30180 WP_001217074.1.30202 WP_001217074.1.30210 WP_001217074.1.30278 WP_001217074.1.30437 WP_001217074.1.30492 WP_001217074.1.30505 WP_001217074.1.30507 WP_001217074.1.30547 WP_001217074.1.30548 WP_001217074.1.30589 WP_001217074.1.30627 WP_001217074.1.3067 WP_001217074.1.3068 WP_001217074.1.30752 WP_001217074.1.30794 WP_001217074.1.3080 WP_001217074.1.30802 WP_001217074.1.30833 WP_001217074.1.30835 WP_001217074.1.30968 WP_001217074.1.30972 WP_001217074.1.31 WP_001217074.1.31092 WP_001217074.1.3113 WP_001217074.1.3114 WP_001217074.1.31167 WP_001217074.1.3119 WP_001217074.1.31190 WP_001217074.1.31195 WP_001217074.1.31196 WP_001217074.1.31222 WP_001217074.1.31272 WP_001217074.1.31335 WP_001217074.1.31362 WP_001217074.1.31435 WP_001217074.1.31451 WP_001217074.1.31504 WP_001217074.1.31515 WP_001217074.1.31578 WP_001217074.1.31585 WP_001217074.1.31658 WP_001217074.1.31665 WP_001217074.1.3167 WP_001217074.1.31725 WP_001217074.1.31854 WP_001217074.1.31895 WP_001217074.1.31901 WP_001217074.1.31940 WP_001217074.1.31952 WP_001217074.1.31983 WP_001217074.1.32109 WP_001217074.1.32116 WP_001217074.1.32192 WP_001217074.1.32206 WP_001217074.1.32252 WP_001217074.1.32260 WP_001217074.1.32274 WP_001217074.1.32309 WP_001217074.1.32408 WP_001217074.1.32423 WP_001217074.1.32438 WP_001217074.1.32491 WP_001217074.1.32515 WP_001217074.1.32519 WP_001217074.1.32668 WP_001217074.1.32702 WP_001217074.1.32832 WP_001217074.1.32881 WP_001217074.1.32899 WP_001217074.1.32977 WP_001217074.1.33030 WP_001217074.1.33106 WP_001217074.1.33127 WP_001217074.1.33143 WP_001217074.1.33160 WP_001217074.1.33248 WP_001217074.1.33253 WP_001217074.1.33261 WP_001217074.1.33270 WP_001217074.1.333 WP_001217074.1.33409 WP_001217074.1.33492 WP_001217074.1.335 WP_001217074.1.33553 WP_001217074.1.3356 WP_001217074.1.33580 WP_001217074.1.33586 WP_001217074.1.33592 WP_001217074.1.33629 WP_001217074.1.3364 WP_001217074.1.33865 WP_001217074.1.33894 WP_001217074.1.3394 WP_001217074.1.3396 WP_001217074.1.33986 WP_001217074.1.34 WP_001217074.1.34043 WP_001217074.1.34075 WP_001217074.1.34091 WP_001217074.1.34126 WP_001217074.1.34185 WP_001217074.1.34257 WP_001217074.1.34279 WP_001217074.1.34292 WP_001217074.1.3438 WP_001217074.1.34417 WP_001217074.1.34431 WP_001217074.1.34454 WP_001217074.1.34458 WP_001217074.1.34614 WP_001217074.1.34684 WP_001217074.1.34711 WP_001217074.1.3476 WP_001217074.1.34820 WP_001217074.1.34854 WP_001217074.1.34972 WP_001217074.1.34975 WP_001217074.1.35045 WP_001217074.1.35129 WP_001217074.1.35184 WP_001217074.1.35193 WP_001217074.1.35219 WP_001217074.1.35298 WP_001217074.1.35321 WP_001217074.1.35332 WP_001217074.1.35404 WP_001217074.1.35408 WP_001217074.1.35425 WP_001217074.1.35446 WP_001217074.1.35460 WP_001217074.1.35463 WP_001217074.1.35503 WP_001217074.1.35509 WP_001217074.1.35563 WP_001217074.1.35570 WP_001217074.1.35590 WP_001217074.1.35594 WP_001217074.1.35619 WP_001217074.1.35624 WP_001217074.1.35648 WP_001217074.1.3572 WP_001217074.1.35887 WP_001217074.1.35892 WP_001217074.1.35936 WP_001217074.1.35940 WP_001217074.1.35993 WP_001217074.1.36003 WP_001217074.1.3601 WP_001217074.1.36011 WP_001217074.1.36017 WP_001217074.1.36037 WP_001217074.1.36063 WP_001217074.1.36236 WP_001217074.1.36409 WP_001217074.1.36445 WP_001217074.1.36547 WP_001217074.1.36584 WP_001217074.1.36685 WP_001217074.1.3670 WP_001217074.1.36705 WP_001217074.1.36721 WP_001217074.1.36764 WP_001217074.1.36889 WP_001217074.1.36899 WP_001217074.1.36931 WP_001217074.1.36949 WP_001217074.1.37013 WP_001217074.1.37029 WP_001217074.1.37073 WP_001217074.1.37111 WP_001217074.1.37112 WP_001217074.1.37114 WP_001217074.1.37190 WP_001217074.1.37191 WP_001217074.1.37256 WP_001217074.1.3726 WP_001217074.1.37293 WP_001217074.1.37297 WP_001217074.1.37370 WP_001217074.1.37405 WP_001217074.1.3744 WP_001217074.1.37478 WP_001217074.1.3748 WP_001217074.1.37498 WP_001217074.1.37521 WP_001217074.1.3756 WP_001217074.1.37618 WP_001217074.1.3771 WP_001217074.1.3778 WP_001217074.1.37864 WP_001217074.1.3790 WP_001217074.1.37968 WP_001217074.1.37978 WP_001217074.1.38037 WP_001217074.1.38047 WP_001217074.1.383 WP_001217074.1.38344 WP_001217074.1.38393 WP_001217074.1.38408 WP_001217074.1.3848 WP_001217074.1.38569 WP_001217074.1.38673 WP_001217074.1.38693 WP_001217074.1.38781 WP_001217074.1.38898 WP_001217074.1.38913 WP_001217074.1.39048 WP_001217074.1.39055 WP_001217074.1.39065 WP_001217074.1.39082 WP_001217074.1.39113 WP_001217074.1.39136 WP_001217074.1.39197 WP_001217074.1.39229 WP_001217074.1.39265 WP_001217074.1.39311 WP_001217074.1.39312 WP_001217074.1.39395 WP_001217074.1.39405 WP_001217074.1.39414 WP_001217074.1.39471 WP_001217074.1.39497 WP_001217074.1.39512 WP_001217074.1.39553 WP_001217074.1.39584 WP_001217074.1.39609 WP_001217074.1.39614 WP_001217074.1.39629 WP_001217074.1.39632 WP_001217074.1.39724 WP_001217074.1.39763 WP_001217074.1.39862 WP_001217074.1.39921 WP_001217074.1.39923 WP_001217074.1.40017 WP_001217074.1.40072 WP_001217074.1.40073 WP_001217074.1.40081 WP_001217074.1.4011 WP_001217074.1.40158 WP_001217074.1.40208 WP_001217074.1.40229 WP_001217074.1.40240 WP_001217074.1.40257 WP_001217074.1.40258 WP_001217074.1.40259 WP_001217074.1.40284 WP_001217074.1.40292 WP_001217074.1.40307 WP_001217074.1.40341 WP_001217074.1.40395 WP_001217074.1.40465 WP_001217074.1.40493 WP_001217074.1.40508 WP_001217074.1.40528 WP_001217074.1.40533 WP_001217074.1.40577 WP_001217074.1.40622 WP_001217074.1.40695 WP_001217074.1.40710 WP_001217074.1.40745 WP_001217074.1.4075 WP_001217074.1.40849 WP_001217074.1.4087 WP_001217074.1.40877 WP_001217074.1.40930 WP_001217074.1.40973 WP_001217074.1.40979 WP_001217074.1.40996 WP_001217074.1.41017 WP_001217074.1.41018 WP_001217074.1.41086 WP_001217074.1.41091 WP_001217074.1.41116 WP_001217074.1.41128 WP_001217074.1.41192 WP_001217074.1.41277 WP_001217074.1.41279 WP_001217074.1.41310 WP_001217074.1.4141 WP_001217074.1.41427 WP_001217074.1.41434 WP_001217074.1.41438 WP_001217074.1.41440 WP_001217074.1.41516 WP_001217074.1.41528 WP_001217074.1.41554 WP_001217074.1.41591 WP_001217074.1.41610 WP_001217074.1.41688 WP_001217074.1.41690 WP_001217074.1.41735 WP_001217074.1.41761 WP_001217074.1.41789 WP_001217074.1.41799 WP_001217074.1.41802 WP_001217074.1.41877 WP_001217074.1.41882 WP_001217074.1.41911 WP_001217074.1.41949 WP_001217074.1.41978 WP_001217074.1.41979 WP_001217074.1.41998 WP_001217074.1.42009 WP_001217074.1.42136 WP_001217074.1.42156 WP_001217074.1.422 WP_001217074.1.4222 WP_001217074.1.42243 WP_001217074.1.42263 WP_001217074.1.42320 WP_001217074.1.42322 WP_001217074.1.4239 WP_001217074.1.42392 WP_001217074.1.42422 WP_001217074.1.42444 WP_001217074.1.42595 WP_001217074.1.42666 WP_001217074.1.42675 WP_001217074.1.42676 WP_001217074.1.42683 WP_001217074.1.42707 WP_001217074.1.42734 WP_001217074.1.42864 WP_001217074.1.4289 WP_001217074.1.42892 WP_001217074.1.42932 WP_001217074.1.43041 WP_001217074.1.43077 WP_001217074.1.43086 WP_001217074.1.43160 WP_001217074.1.43201 WP_001217074.1.43244 WP_001217074.1.43276 WP_001217074.1.43312 WP_001217074.1.43339 WP_001217074.1.43371 WP_001217074.1.43437 WP_001217074.1.43438 WP_001217074.1.4344 WP_001217074.1.43441 WP_001217074.1.43476 WP_001217074.1.43528 WP_001217074.1.43613 WP_001217074.1.43668 WP_001217074.1.43685 WP_001217074.1.43710 WP_001217074.1.43711 WP_001217074.1.4373 WP_001217074.1.43778 WP_001217074.1.43785 WP_001217074.1.43886 WP_001217074.1.43951 WP_001217074.1.44005 WP_001217074.1.44010 WP_001217074.1.44043 WP_001217074.1.44099 WP_001217074.1.44121 WP_001217074.1.44187 WP_001217074.1.44291 WP_001217074.1.44300 WP_001217074.1.44310 WP_001217074.1.44337 WP_001217074.1.44386 WP_001217074.1.44397 WP_001217074.1.44433 WP_001217074.1.44474 WP_001217074.1.44479 WP_001217074.1.44607 WP_001217074.1.44640 WP_001217074.1.4467 WP_001217074.1.44831 WP_001217074.1.4485 WP_001217074.1.44877 WP_001217074.1.449 WP_001217074.1.44933 WP_001217074.1.44966 WP_001217074.1.44978 WP_001217074.1.44997 WP_001217074.1.4500 WP_001217074.1.45067 WP_001217074.1.45074 WP_001217074.1.45079 WP_001217074.1.45145 WP_001217074.1.45173 WP_001217074.1.45177 WP_001217074.1.45184 WP_001217074.1.45259 WP_001217074.1.45302 WP_001217074.1.4531 WP_001217074.1.45349 WP_001217074.1.45365 WP_001217074.1.4540 WP_001217074.1.45432 WP_001217074.1.45434 WP_001217074.1.45535 WP_001217074.1.45549 WP_001217074.1.45550 WP_001217074.1.45569 WP_001217074.1.45571 WP_001217074.1.45583 WP_001217074.1.45585 WP_001217074.1.45622 WP_001217074.1.45660 WP_001217074.1.45690 WP_001217074.1.45781 WP_001217074.1.45844 WP_001217074.1.45906 WP_001217074.1.45918 WP_001217074.1.4592 WP_001217074.1.46011 WP_001217074.1.46069 WP_001217074.1.46091 WP_001217074.1.46112 WP_001217074.1.46174 WP_001217074.1.46187 WP_001217074.1.46203 WP_001217074.1.46205 WP_001217074.1.46215 WP_001217074.1.46278 WP_001217074.1.46303 WP_001217074.1.46323 WP_001217074.1.46434 WP_001217074.1.46572 WP_001217074.1.46578 WP_001217074.1.46595 WP_001217074.1.46726 WP_001217074.1.46732 WP_001217074.1.4674 WP_001217074.1.4686 WP_001217074.1.46967 WP_001217074.1.46976 WP_001217074.1.47008 WP_001217074.1.47057 WP_001217074.1.47067 WP_001217074.1.47214 WP_001217074.1.47389 WP_001217074.1.47429 WP_001217074.1.4747 WP_001217074.1.47472 WP_001217074.1.47478 WP_001217074.1.47482 WP_001217074.1.47506 WP_001217074.1.47507 WP_001217074.1.47567 WP_001217074.1.47576 WP_001217074.1.47579 WP_001217074.1.4758 WP_001217074.1.47621 WP_001217074.1.4770 WP_001217074.1.4775 WP_001217074.1.47799 WP_001217074.1.47829 WP_001217074.1.47849 WP_001217074.1.47850 WP_001217074.1.47875 WP_001217074.1.47902 WP_001217074.1.47911 WP_001217074.1.4795 WP_001217074.1.47988 WP_001217074.1.47992 WP_001217074.1.48268 WP_001217074.1.48367 WP_001217074.1.48377 WP_001217074.1.4839 WP_001217074.1.4853 WP_001217074.1.48755 WP_001217074.1.48788 WP_001217074.1.48797 WP_001217074.1.48855 WP_001217074.1.48876 WP_001217074.1.48894 WP_001217074.1.48919 WP_001217074.1.49012 WP_001217074.1.49084 WP_001217074.1.49113 WP_001217074.1.49155 WP_001217074.1.49204 WP_001217074.1.49239 WP_001217074.1.49256 WP_001217074.1.49290 WP_001217074.1.49311 WP_001217074.1.49334 WP_001217074.1.49366 WP_001217074.1.49490 WP_001217074.1.49515 WP_001217074.1.49572 WP_001217074.1.49686 WP_001217074.1.49770 WP_001217074.1.4979 WP_001217074.1.49803 WP_001217074.1.49929 WP_001217074.1.50080 WP_001217074.1.50128 WP_001217074.1.50161 WP_001217074.1.50251 WP_001217074.1.50285 WP_001217074.1.50332 WP_001217074.1.50374 WP_001217074.1.50376 WP_001217074.1.50389 WP_001217074.1.50404 WP_001217074.1.50449 WP_001217074.1.50576 WP_001217074.1.5058 WP_001217074.1.50652 WP_001217074.1.50676 WP_001217074.1.50684 WP_001217074.1.50804 WP_001217074.1.50808 WP_001217074.1.50811 WP_001217074.1.5088 WP_001217074.1.50882 WP_001217074.1.50905 WP_001217074.1.50941 WP_001217074.1.50960 WP_001217074.1.50999 WP_001217074.1.51014 WP_001217074.1.51066 WP_001217074.1.51131 WP_001217074.1.51178 WP_001217074.1.51182 WP_001217074.1.51186 WP_001217074.1.51224 WP_001217074.1.51356 WP_001217074.1.51394 WP_001217074.1.51412 WP_001217074.1.51414 WP_001217074.1.51451 WP_001217074.1.51487 WP_001217074.1.51502 WP_001217074.1.51518 WP_001217074.1.51613 WP_001217074.1.51634 WP_001217074.1.51642 WP_001217074.1.51649 WP_001217074.1.51686 WP_001217074.1.51700 WP_001217074.1.51756 WP_001217074.1.51764 WP_001217074.1.51810 WP_001217074.1.51831 WP_001217074.1.51868 WP_001217074.1.51911 WP_001217074.1.51930 WP_001217074.1.51932 WP_001217074.1.51989 WP_001217074.1.51994 WP_001217074.1.520 WP_001217074.1.52047 WP_001217074.1.5211 WP_001217074.1.52121 WP_001217074.1.52156 WP_001217074.1.52161 WP_001217074.1.52170 WP_001217074.1.52255 WP_001217074.1.52301 WP_001217074.1.52321 WP_001217074.1.52336 WP_001217074.1.52346 WP_001217074.1.52353 WP_001217074.1.52582 WP_001217074.1.52586 WP_001217074.1.52608 WP_001217074.1.52653 WP_001217074.1.52656 WP_001217074.1.52692 WP_001217074.1.52743 WP_001217074.1.52744 WP_001217074.1.52748 WP_001217074.1.52833 WP_001217074.1.52857 WP_001217074.1.52858 WP_001217074.1.52866 WP_001217074.1.52949 WP_001217074.1.52985 WP_001217074.1.53107 WP_001217074.1.53119 WP_001217074.1.5313 WP_001217074.1.5316 WP_001217074.1.53198 WP_001217074.1.53234 WP_001217074.1.53272 WP_001217074.1.53362 WP_001217074.1.53385 WP_001217074.1.53406 WP_001217074.1.53529 WP_001217074.1.53543 WP_001217074.1.53567 WP_001217074.1.53664 WP_001217074.1.53696 WP_001217074.1.53757 WP_001217074.1.53772 WP_001217074.1.53778 WP_001217074.1.53781 WP_001217074.1.53812 WP_001217074.1.53896 WP_001217074.1.53905 WP_001217074.1.53961 WP_001217074.1.54033 WP_001217074.1.54068 WP_001217074.1.54075 WP_001217074.1.54159 WP_001217074.1.54209 WP_001217074.1.54274 WP_001217074.1.54283 WP_001217074.1.54319 WP_001217074.1.54364 WP_001217074.1.54366 WP_001217074.1.54400 WP_001217074.1.54469 WP_001217074.1.54522 WP_001217074.1.54526 WP_001217074.1.5456 WP_001217074.1.54615 WP_001217074.1.54662 WP_001217074.1.54694 WP_001217074.1.54722 WP_001217074.1.54749 WP_001217074.1.54764 WP_001217074.1.54774 WP_001217074.1.54814 WP_001217074.1.54833 WP_001217074.1.54845 WP_001217074.1.5485 WP_001217074.1.54877 WP_001217074.1.54936 WP_001217074.1.54992 WP_001217074.1.55008 WP_001217074.1.55073 WP_001217074.1.55152 WP_001217074.1.55178 WP_001217074.1.5523 WP_001217074.1.55285 WP_001217074.1.55294 WP_001217074.1.55325 WP_001217074.1.55418 WP_001217074.1.55430 WP_001217074.1.55475 WP_001217074.1.55477 WP_001217074.1.55496 WP_001217074.1.5555 WP_001217074.1.55557 WP_001217074.1.55559 WP_001217074.1.5560 WP_001217074.1.55640 WP_001217074.1.55647 WP_001217074.1.55706 WP_001217074.1.55718 WP_001217074.1.5572 WP_001217074.1.55743 WP_001217074.1.55768 WP_001217074.1.5577 WP_001217074.1.55796 WP_001217074.1.55853 WP_001217074.1.55923 WP_001217074.1.55948 WP_001217074.1.55973 WP_001217074.1.56012 WP_001217074.1.56026 WP_001217074.1.56105 WP_001217074.1.56235 WP_001217074.1.56238 WP_001217074.1.56244 WP_001217074.1.56263 WP_001217074.1.56286 WP_001217074.1.56304 WP_001217074.1.56389 WP_001217074.1.56414 WP_001217074.1.56559 WP_001217074.1.56560 WP_001217074.1.56601 WP_001217074.1.56614 WP_001217074.1.56647 WP_001217074.1.56651 WP_001217074.1.56660 WP_001217074.1.56671 WP_001217074.1.5668 WP_001217074.1.56682 WP_001217074.1.56851 WP_001217074.1.56861 WP_001217074.1.56875 WP_001217074.1.56877 WP_001217074.1.56898 WP_001217074.1.56950 WP_001217074.1.57000 WP_001217074.1.57026 WP_001217074.1.57039 WP_001217074.1.57056 WP_001217074.1.5711 WP_001217074.1.57125 WP_001217074.1.57143 WP_001217074.1.57168 WP_001217074.1.57187 WP_001217074.1.57246 WP_001217074.1.57296 WP_001217074.1.57356 WP_001217074.1.57362 WP_001217074.1.57377 WP_001217074.1.57433 WP_001217074.1.57510 WP_001217074.1.57555 WP_001217074.1.57559 WP_001217074.1.57576 WP_001217074.1.57601 WP_001217074.1.57607 WP_001217074.1.57631 WP_001217074.1.5774 WP_001217074.1.57797 WP_001217074.1.57862 WP_001217074.1.57890 WP_001217074.1.57891 WP_001217074.1.57893 WP_001217074.1.58041 WP_001217074.1.58090 WP_001217074.1.5828 WP_001217074.1.58290 WP_001217074.1.58358 WP_001217074.1.58407 WP_001217074.1.58418 WP_001217074.1.58443 WP_001217074.1.58451 WP_001217074.1.58486 WP_001217074.1.58489 WP_001217074.1.58548 WP_001217074.1.58564 WP_001217074.1.5858 WP_001217074.1.58604 WP_001217074.1.58662 WP_001217074.1.58669 WP_001217074.1.58675 WP_001217074.1.587 WP_001217074.1.58745 WP_001217074.1.58749 WP_001217074.1.58803 WP_001217074.1.58831 WP_001217074.1.58836 WP_001217074.1.5886 WP_001217074.1.58861 WP_001217074.1.58884 WP_001217074.1.58926 WP_001217074.1.59094 WP_001217074.1.59136 WP_001217074.1.59142 WP_001217074.1.59163 WP_001217074.1.59224 WP_001217074.1.59321 WP_001217074.1.59335 WP_001217074.1.59375 WP_001217074.1.59420 WP_001217074.1.59427 WP_001217074.1.59490 WP_001217074.1.59508 WP_001217074.1.59538 WP_001217074.1.59548 WP_001217074.1.59604 WP_001217074.1.59646 WP_001217074.1.59684 WP_001217074.1.59694 WP_001217074.1.59709 WP_001217074.1.59848 WP_001217074.1.60008 WP_001217074.1.60021 WP_001217074.1.60069 WP_001217074.1.60126 WP_001217074.1.60137 WP_001217074.1.60155 WP_001217074.1.60209 WP_001217074.1.60320 WP_001217074.1.6033 WP_001217074.1.60370 WP_001217074.1.60379 WP_001217074.1.60425 WP_001217074.1.60464 WP_001217074.1.60545 WP_001217074.1.60560 WP_001217074.1.60561 WP_001217074.1.60597 WP_001217074.1.60713 WP_001217074.1.60772 WP_001217074.1.60794 WP_001217074.1.608 WP_001217074.1.60855 WP_001217074.1.60866 WP_001217074.1.60897 WP_001217074.1.6090 WP_001217074.1.60941 WP_001217074.1.61146 WP_001217074.1.61201 WP_001217074.1.61218 WP_001217074.1.6129 WP_001217074.1.61296 WP_001217074.1.61356 WP_001217074.1.61381 WP_001217074.1.61417 WP_001217074.1.61497 WP_001217074.1.61501 WP_001217074.1.61594 WP_001217074.1.61595 WP_001217074.1.61662 WP_001217074.1.61671 WP_001217074.1.61712 WP_001217074.1.61730 WP_001217074.1.61783 WP_001217074.1.61908 WP_001217074.1.61918 WP_001217074.1.61952 WP_001217074.1.62007 WP_001217074.1.62020 WP_001217074.1.62025 WP_001217074.1.62076 WP_001217074.1.6209 WP_001217074.1.62158 WP_001217074.1.62201 WP_001217074.1.62204 WP_001217074.1.62210 WP_001217074.1.62245 WP_001217074.1.62257 WP_001217074.1.62271 WP_001217074.1.62304 WP_001217074.1.62339 WP_001217074.1.62361 WP_001217074.1.62364 WP_001217074.1.62374 WP_001217074.1.62403 WP_001217074.1.62412 WP_001217074.1.6253 WP_001217074.1.62619 WP_001217074.1.627 WP_001217074.1.62745 WP_001217074.1.62757 WP_001217074.1.62853 WP_001217074.1.62903 WP_001217074.1.62910 WP_001217074.1.6292 WP_001217074.1.62955 WP_001217074.1.62983 WP_001217074.1.62988 WP_001217074.1.63045 WP_001217074.1.63102 WP_001217074.1.63129 WP_001217074.1.63186 WP_001217074.1.63203 WP_001217074.1.63229 WP_001217074.1.63243 WP_001217074.1.63250 WP_001217074.1.63358 WP_001217074.1.63382 WP_001217074.1.63422 WP_001217074.1.63432 WP_001217074.1.63461 WP_001217074.1.63497 WP_001217074.1.63509 WP_001217074.1.63529 WP_001217074.1.63577 WP_001217074.1.63585 WP_001217074.1.63603 WP_001217074.1.6370 WP_001217074.1.63718 WP_001217074.1.63748 WP_001217074.1.63766 WP_001217074.1.63781 WP_001217074.1.63782 WP_001217074.1.63797 WP_001217074.1.63834 WP_001217074.1.63851 WP_001217074.1.63863 WP_001217074.1.6399 WP_001217074.1.64010 WP_001217074.1.64018 WP_001217074.1.64046 WP_001217074.1.64085 WP_001217074.1.64109 WP_001217074.1.64121 WP_001217074.1.64157 WP_001217074.1.64208 WP_001217074.1.64229 WP_001217074.1.6423 WP_001217074.1.64244 WP_001217074.1.64350 WP_001217074.1.64385 WP_001217074.1.64387 WP_001217074.1.64403 WP_001217074.1.64462 WP_001217074.1.64500 WP_001217074.1.64597 WP_001217074.1.64645 WP_001217074.1.64649 WP_001217074.1.64674 WP_001217074.1.64690 WP_001217074.1.64702 WP_001217074.1.64711 WP_001217074.1.64757 WP_001217074.1.64781 WP_001217074.1.64831 WP_001217074.1.64894 WP_001217074.1.64920 WP_001217074.1.64977 WP_001217074.1.65011 WP_001217074.1.65028 WP_001217074.1.65168 WP_001217074.1.65171 WP_001217074.1.65185 WP_001217074.1.65238 WP_001217074.1.65248 WP_001217074.1.65269 WP_001217074.1.6535 WP_001217074.1.65357 WP_001217074.1.65363 WP_001217074.1.65394 WP_001217074.1.65474 WP_001217074.1.65601 WP_001217074.1.65633 WP_001217074.1.6565 WP_001217074.1.65696 WP_001217074.1.65698 WP_001217074.1.65771 WP_001217074.1.65790 WP_001217074.1.65876 WP_001217074.1.65881 WP_001217074.1.65883 WP_001217074.1.65901 WP_001217074.1.65940 WP_001217074.1.6595 WP_001217074.1.65956 WP_001217074.1.66049 WP_001217074.1.66122 WP_001217074.1.66129 WP_001217074.1.66171 WP_001217074.1.66289 WP_001217074.1.6630 WP_001217074.1.66314 WP_001217074.1.66315 WP_001217074.1.66330 WP_001217074.1.66362 WP_001217074.1.66365 WP_001217074.1.6638 WP_001217074.1.66385 WP_001217074.1.66400 WP_001217074.1.66428 WP_001217074.1.66446 WP_001217074.1.66539 WP_001217074.1.66600 WP_001217074.1.66630 WP_001217074.1.66678 WP_001217074.1.66698 WP_001217074.1.66733 WP_001217074.1.6680 WP_001217074.1.66824 WP_001217074.1.66834 WP_001217074.1.66876 WP_001217074.1.66937 WP_001217074.1.66959 WP_001217074.1.66962 WP_001217074.1.67 WP_001217074.1.67037 WP_001217074.1.67075 WP_001217074.1.6710 WP_001217074.1.67100 WP_001217074.1.67173 WP_001217074.1.67181 WP_001217074.1.67235 WP_001217074.1.67279 WP_001217074.1.67347 WP_001217074.1.6739 WP_001217074.1.67465 WP_001217074.1.67552 WP_001217074.1.6760 WP_001217074.1.67776 WP_001217074.1.67803 WP_001217074.1.6782 WP_001217074.1.67827 WP_001217074.1.67829 WP_001217074.1.67905 WP_001217074.1.67932 WP_001217074.1.67942 WP_001217074.1.67977 WP_001217074.1.68073 WP_001217074.1.6809 WP_001217074.1.68140 WP_001217074.1.68159 WP_001217074.1.68201 WP_001217074.1.68206 WP_001217074.1.68210 WP_001217074.1.6827 WP_001217074.1.6833 WP_001217074.1.68401 WP_001217074.1.68477 WP_001217074.1.68478 WP_001217074.1.6849 WP_001217074.1.68547 WP_001217074.1.68589 WP_001217074.1.68591 WP_001217074.1.68652 WP_001217074.1.68677 WP_001217074.1.68778 WP_001217074.1.68787 WP_001217074.1.6879 WP_001217074.1.68893 WP_001217074.1.68895 WP_001217074.1.68928 WP_001217074.1.68975 WP_001217074.1.69001 WP_001217074.1.69006 WP_001217074.1.6904 WP_001217074.1.6907 WP_001217074.1.69080 WP_001217074.1.69086 WP_001217074.1.6913 WP_001217074.1.69131 WP_001217074.1.69146 WP_001217074.1.69151 WP_001217074.1.69236 WP_001217074.1.69255 WP_001217074.1.69273 WP_001217074.1.69320 WP_001217074.1.69357 WP_001217074.1.69359 WP_001217074.1.69485 WP_001217074.1.69515 WP_001217074.1.6954 WP_001217074.1.69575 WP_001217074.1.69616 WP_001217074.1.69644 WP_001217074.1.69704 WP_001217074.1.69758 WP_001217074.1.69767 WP_001217074.1.69807 WP_001217074.1.69808 WP_001217074.1.69848 WP_001217074.1.69965 WP_001217074.1.69975 WP_001217074.1.70088 WP_001217074.1.7016 WP_001217074.1.7021 WP_001217074.1.70269 WP_001217074.1.70272 WP_001217074.1.70303 WP_001217074.1.70440 WP_001217074.1.70485 WP_001217074.1.70488 WP_001217074.1.70531 WP_001217074.1.70580 WP_001217074.1.70596 WP_001217074.1.70643 WP_001217074.1.70678 WP_001217074.1.70732 WP_001217074.1.70785 WP_001217074.1.70837 WP_001217074.1.70914 WP_001217074.1.70922 WP_001217074.1.70929 WP_001217074.1.70948 WP_001217074.1.70959 WP_001217074.1.70969 WP_001217074.1.70977 WP_001217074.1.70985 WP_001217074.1.71010 WP_001217074.1.71023 WP_001217074.1.71146 WP_001217074.1.71171 WP_001217074.1.71172 WP_001217074.1.71184 WP_001217074.1.71188 WP_001217074.1.71201 WP_001217074.1.71248 WP_001217074.1.71305 WP_001217074.1.71306 WP_001217074.1.71337 WP_001217074.1.71363 WP_001217074.1.71368 WP_001217074.1.71378 WP_001217074.1.71401 WP_001217074.1.71600 WP_001217074.1.71626 WP_001217074.1.71636 WP_001217074.1.71649 WP_001217074.1.71702 WP_001217074.1.71750 WP_001217074.1.71798 WP_001217074.1.71845 WP_001217074.1.71908 WP_001217074.1.71929 WP_001217074.1.71952 WP_001217074.1.71973 WP_001217074.1.71979 WP_001217074.1.71984 WP_001217074.1.720 WP_001217074.1.72068 WP_001217074.1.72100 WP_001217074.1.72105 WP_001217074.1.72182 WP_001217074.1.72188 WP_001217074.1.72190 WP_001217074.1.72203 WP_001217074.1.72220 WP_001217074.1.72221 WP_001217074.1.72300 WP_001217074.1.72325 WP_001217074.1.72339 WP_001217074.1.72376 WP_001217074.1.72403 WP_001217074.1.72470 WP_001217074.1.72532 WP_001217074.1.72594 WP_001217074.1.72602 WP_001217074.1.72625 WP_001217074.1.72642 WP_001217074.1.72716 WP_001217074.1.72718 WP_001217074.1.72728 WP_001217074.1.72850 WP_001217074.1.72865 WP_001217074.1.72872 WP_001217074.1.72887 WP_001217074.1.7295 WP_001217074.1.72968 WP_001217074.1.72975 WP_001217074.1.73068 WP_001217074.1.73125 WP_001217074.1.7315 WP_001217074.1.7334 WP_001217074.1.73377 WP_001217074.1.7341 WP_001217074.1.7356 WP_001217074.1.73596 WP_001217074.1.73617 WP_001217074.1.73669 WP_001217074.1.73701 WP_001217074.1.73708 WP_001217074.1.73753 WP_001217074.1.73758 WP_001217074.1.73764 WP_001217074.1.73794 WP_001217074.1.73847 WP_001217074.1.73901 WP_001217074.1.73924 WP_001217074.1.73956 WP_001217074.1.74029 WP_001217074.1.74174 WP_001217074.1.74181 WP_001217074.1.74191 WP_001217074.1.74248 WP_001217074.1.743 WP_001217074.1.74300 WP_001217074.1.74379 WP_001217074.1.74410 WP_001217074.1.74422 WP_001217074.1.745 WP_001217074.1.74500 WP_001217074.1.74529 WP_001217074.1.74545 WP_001217074.1.74578 WP_001217074.1.7458 WP_001217074.1.74661 WP_001217074.1.74826 WP_001217074.1.7491 WP_001217074.1.74972 WP_001217074.1.75009 WP_001217074.1.75051 WP_001217074.1.75056 WP_001217074.1.75129 WP_001217074.1.75148 WP_001217074.1.75159 WP_001217074.1.75187 WP_001217074.1.75334 WP_001217074.1.75362 WP_001217074.1.75385 WP_001217074.1.75400 WP_001217074.1.75450 WP_001217074.1.7558 WP_001217074.1.75607 WP_001217074.1.75609 WP_001217074.1.75703 WP_001217074.1.75716 WP_001217074.1.75751 WP_001217074.1.75760 WP_001217074.1.75764 WP_001217074.1.75794 WP_001217074.1.75810 WP_001217074.1.75828 WP_001217074.1.75837 WP_001217074.1.75863 WP_001217074.1.75873 WP_001217074.1.75874 WP_001217074.1.75884 WP_001217074.1.75902 WP_001217074.1.76020 WP_001217074.1.76024 WP_001217074.1.76108 WP_001217074.1.76137 WP_001217074.1.76197 WP_001217074.1.76327 WP_001217074.1.76345 WP_001217074.1.76445 WP_001217074.1.76451 WP_001217074.1.76495 WP_001217074.1.76548 WP_001217074.1.76576 WP_001217074.1.7660 WP_001217074.1.76673 WP_001217074.1.76721 WP_001217074.1.76724 WP_001217074.1.76760 WP_001217074.1.76776 WP_001217074.1.76875 WP_001217074.1.76899 WP_001217074.1.76913 WP_001217074.1.76968 WP_001217074.1.77038 WP_001217074.1.77047 WP_001217074.1.77067 WP_001217074.1.7712 WP_001217074.1.77177 WP_001217074.1.77180 WP_001217074.1.77184 WP_001217074.1.77193 WP_001217074.1.77244 WP_001217074.1.77267 WP_001217074.1.77292 WP_001217074.1.77306 WP_001217074.1.77349 WP_001217074.1.77356 WP_001217074.1.77390 WP_001217074.1.77414 WP_001217074.1.77475 WP_001217074.1.77496 WP_001217074.1.77514 WP_001217074.1.77549 WP_001217074.1.77653 WP_001217074.1.77710 WP_001217074.1.77851 WP_001217074.1.7792 WP_001217074.1.7793 WP_001217074.1.77951 WP_001217074.1.77960 WP_001217074.1.77971 WP_001217074.1.77983 WP_001217074.1.77989 WP_001217074.1.7802 WP_001217074.1.78033 WP_001217074.1.78051 WP_001217074.1.78053 WP_001217074.1.78076 WP_001217074.1.78096 WP_001217074.1.78100 WP_001217074.1.78301 WP_001217074.1.78372 WP_001217074.1.78383 WP_001217074.1.78443 WP_001217074.1.78495 WP_001217074.1.78496 WP_001217074.1.78501 WP_001217074.1.78603 WP_001217074.1.78632 WP_001217074.1.78658 WP_001217074.1.78697 WP_001217074.1.78734 WP_001217074.1.78735 WP_001217074.1.78738 WP_001217074.1.7877 WP_001217074.1.78802 WP_001217074.1.78815 WP_001217074.1.78830 WP_001217074.1.78835 WP_001217074.1.78838 WP_001217074.1.78862 WP_001217074.1.78871 WP_001217074.1.78874 WP_001217074.1.78877 WP_001217074.1.78896 WP_001217074.1.7891 WP_001217074.1.78918 WP_001217074.1.78930 WP_001217074.1.79099 WP_001217074.1.79167 WP_001217074.1.79289 WP_001217074.1.79370 WP_001217074.1.79462 WP_001217074.1.79468 WP_001217074.1.79490 WP_001217074.1.79495 WP_001217074.1.79529 WP_001217074.1.79580 WP_001217074.1.79586 WP_001217074.1.79635 WP_001217074.1.7964 WP_001217074.1.79642 WP_001217074.1.79659 WP_001217074.1.79668 WP_001217074.1.79708 WP_001217074.1.79734 WP_001217074.1.79757 WP_001217074.1.7979 WP_001217074.1.7982 WP_001217074.1.79832 WP_001217074.1.7991 WP_001217074.1.79910 WP_001217074.1.79951 WP_001217074.1.80077 WP_001217074.1.80137 WP_001217074.1.80249 WP_001217074.1.80250 WP_001217074.1.80254 WP_001217074.1.80293 WP_001217074.1.80296 WP_001217074.1.80366 WP_001217074.1.80380 WP_001217074.1.80443 WP_001217074.1.80448 WP_001217074.1.80542 WP_001217074.1.80609 WP_001217074.1.80629 WP_001217074.1.80651 WP_001217074.1.80741 WP_001217074.1.80760 WP_001217074.1.80780 WP_001217074.1.80831 WP_001217074.1.80850 WP_001217074.1.80857 WP_001217074.1.80874 WP_001217074.1.80876 WP_001217074.1.80881 WP_001217074.1.8096 WP_001217074.1.8106 WP_001217074.1.81069 WP_001217074.1.81109 WP_001217074.1.81110 WP_001217074.1.81149 WP_001217074.1.81175 WP_001217074.1.8119 WP_001217074.1.81197 WP_001217074.1.81225 WP_001217074.1.81275 WP_001217074.1.8130 WP_001217074.1.81302 WP_001217074.1.81305 WP_001217074.1.81320 WP_001217074.1.81328 WP_001217074.1.8134 WP_001217074.1.81354 WP_001217074.1.81388 WP_001217074.1.81425 WP_001217074.1.81455 WP_001217074.1.81504 WP_001217074.1.81528 WP_001217074.1.81668 WP_001217074.1.81735 WP_001217074.1.81760 WP_001217074.1.81768 WP_001217074.1.81785 WP_001217074.1.81795 WP_001217074.1.81902 WP_001217074.1.81995 WP_001217074.1.82099 WP_001217074.1.82149 WP_001217074.1.82192 WP_001217074.1.82232 WP_001217074.1.82269 WP_001217074.1.82337 WP_001217074.1.82395 WP_001217074.1.82401 WP_001217074.1.82420 WP_001217074.1.82434 WP_001217074.1.82464 WP_001217074.1.8247 WP_001217074.1.82474 WP_001217074.1.82503 WP_001217074.1.82529 WP_001217074.1.82569 WP_001217074.1.82570 WP_001217074.1.82648 WP_001217074.1.82676 WP_001217074.1.82761 WP_001217074.1.82886 WP_001217074.1.82937 WP_001217074.1.82946 WP_001217074.1.83005 WP_001217074.1.83006 WP_001217074.1.83204 WP_001217074.1.8322 WP_001217074.1.83305 WP_001217074.1.83331 WP_001217074.1.83354 WP_001217074.1.83356 WP_001217074.1.83378 WP_001217074.1.83407 WP_001217074.1.83491 WP_001217074.1.83510 WP_001217074.1.8354 WP_001217074.1.83558 WP_001217074.1.83760 WP_001217074.1.8399 WP_001217074.1.83995 WP_001217074.1.84000 WP_001217074.1.84001 WP_001217074.1.84011 WP_001217074.1.84075 WP_001217074.1.84077 WP_001217074.1.84083 WP_001217074.1.84086 WP_001217074.1.84100 WP_001217074.1.84103 WP_001217074.1.84154 WP_001217074.1.84168 WP_001217074.1.8425 WP_001217074.1.84283 WP_001217074.1.84291 WP_001217074.1.84300 WP_001217074.1.84397 WP_001217074.1.8441 WP_001217074.1.84461 WP_001217074.1.84515 WP_001217074.1.84532 WP_001217074.1.84572 WP_001217074.1.84598 WP_001217074.1.84659 WP_001217074.1.84876 WP_001217074.1.84899 WP_001217074.1.849 WP_001217074.1.8497 WP_001217074.1.84983 WP_001217074.1.85040 WP_001217074.1.85079 WP_001217074.1.85134 WP_001217074.1.85180 WP_001217074.1.85271 WP_001217074.1.85301 WP_001217074.1.8545 WP_001217074.1.85483 WP_001217074.1.85541 WP_001217074.1.8556 WP_001217074.1.85568 WP_001217074.1.85617 WP_001217074.1.85663 WP_001217074.1.85671 WP_001217074.1.85675 WP_001217074.1.85723 WP_001217074.1.85759 WP_001217074.1.85777 WP_001217074.1.85886 WP_001217074.1.85900 WP_001217074.1.85904 WP_001217074.1.85976 WP_001217074.1.85982 WP_001217074.1.86007 WP_001217074.1.86010 WP_001217074.1.86043 WP_001217074.1.86138 WP_001217074.1.86157 WP_001217074.1.86159 WP_001217074.1.8616 WP_001217074.1.86173 WP_001217074.1.86240 WP_001217074.1.86285 WP_001217074.1.86306 WP_001217074.1.86347 WP_001217074.1.86356 WP_001217074.1.86380 WP_001217074.1.86450 WP_001217074.1.86469 WP_001217074.1.8647 WP_001217074.1.86514 WP_001217074.1.86588 WP_001217074.1.86610 WP_001217074.1.86661 WP_001217074.1.8671 WP_001217074.1.8672 WP_001217074.1.86895 WP_001217074.1.86915 WP_001217074.1.87038 WP_001217074.1.87051 WP_001217074.1.87095 WP_001217074.1.87143 WP_001217074.1.87187 WP_001217074.1.87265 WP_001217074.1.87283 WP_001217074.1.8736 WP_001217074.1.87460 WP_001217074.1.87484 WP_001217074.1.87500 WP_001217074.1.87552 WP_001217074.1.87583 WP_001217074.1.87618 WP_001217074.1.87626 WP_001217074.1.87695 WP_001217074.1.87712 WP_001217074.1.87760 WP_001217074.1.87899 WP_001217074.1.87905 WP_001217074.1.8792 WP_001217074.1.88014 WP_001217074.1.88019 WP_001217074.1.88052 WP_001217074.1.8809 WP_001217074.1.88092 WP_001217074.1.88174 WP_001217074.1.88185 WP_001217074.1.88222 WP_001217074.1.88275 WP_001217074.1.88291 WP_001217074.1.88293 WP_001217074.1.88356 WP_001217074.1.88423 WP_001217074.1.88474 WP_001217074.1.88508 WP_001217074.1.88703 WP_001217074.1.88731 WP_001217074.1.88762 WP_001217074.1.88854 WP_001217074.1.88902 WP_001217074.1.8891 WP_001217074.1.88957 WP_001217074.1.88966 WP_001217074.1.88967 WP_001217074.1.88968 WP_001217074.1.88980 WP_001217074.1.88982 WP_001217074.1.88995 WP_001217074.1.88998 WP_001217074.1.89054 WP_001217074.1.89114 WP_001217074.1.89116 WP_001217074.1.89119 WP_001217074.1.89120 WP_001217074.1.89138 WP_001217074.1.89177 WP_001217074.1.89188 WP_001217074.1.89215 WP_001217074.1.89221 WP_001217074.1.89304 WP_001217074.1.89362 WP_001217074.1.89408 WP_001217074.1.89425 WP_001217074.1.89570 WP_001217074.1.89606 WP_001217074.1.8961 WP_001217074.1.89622 WP_001217074.1.89634 WP_001217074.1.89657 WP_001217074.1.89659 WP_001217074.1.89680 WP_001217074.1.89765 WP_001217074.1.89817 WP_001217074.1.89832 WP_001217074.1.89914 WP_001217074.1.8996 WP_001217074.1.9002 WP_001217074.1.9003 WP_001217074.1.90033 WP_001217074.1.90097 WP_001217074.1.90108 WP_001217074.1.90193 WP_001217074.1.90220 WP_001217074.1.90252 WP_001217074.1.90311 WP_001217074.1.90348 WP_001217074.1.90421 WP_001217074.1.90440 WP_001217074.1.90453 WP_001217074.1.90522 WP_001217074.1.90540 WP_001217074.1.90563 WP_001217074.1.90566 WP_001217074.1.90585 WP_001217074.1.9064 WP_001217074.1.90641 WP_001217074.1.90734 WP_001217074.1.90748 WP_001217074.1.90759 WP_001217074.1.90859 WP_001217074.1.90959 WP_001217074.1.90973 WP_001217074.1.90983 WP_001217074.1.91003 WP_001217074.1.91056 WP_001217074.1.91069 WP_001217074.1.91179 WP_001217074.1.91215 WP_001217074.1.91278 WP_001217074.1.9137 WP_001217074.1.91372 WP_001217074.1.91405 WP_001217074.1.91424 WP_001217074.1.91459 WP_001217074.1.91474 WP_001217074.1.91505 WP_001217074.1.91512 WP_001217074.1.91564 WP_001217074.1.91621 WP_001217074.1.91625 WP_001217074.1.91724 WP_001217074.1.91732 WP_001217074.1.91742 WP_001217074.1.91772 WP_001217074.1.91776 WP_001217074.1.91788 WP_001217074.1.91795 WP_001217074.1.91898 WP_001217074.1.91904 WP_001217074.1.91974 WP_001217074.1.92013 WP_001217074.1.92067 WP_001217074.1.92082 WP_001217074.1.92093 WP_001217074.1.92129 WP_001217074.1.92165 WP_001217074.1.92183 WP_001217074.1.92213 WP_001217074.1.9222 WP_001217074.1.92310 WP_001217074.1.92411 WP_001217074.1.92443 WP_001217074.1.92452 WP_001217074.1.92482 WP_001217074.1.92529 WP_001217074.1.92531 WP_001217074.1.92557 WP_001217074.1.92575 WP_001217074.1.92628 WP_001217074.1.92669 WP_001217074.1.92671 WP_001217074.1.92738 WP_001217074.1.92754 WP_001217074.1.92806 WP_001217074.1.92879 WP_001217074.1.92890 WP_001217074.1.92893 WP_001217074.1.92929 WP_001217074.1.92947 WP_001217074.1.93059 WP_001217074.1.93061 WP_001217074.1.93076 WP_001217074.1.93101 WP_001217074.1.93136 WP_001217074.1.93155 WP_001217074.1.93213 WP_001217074.1.93215 WP_001217074.1.93339 WP_001217074.1.93350 WP_001217074.1.93365 WP_001217074.1.93410 WP_001217074.1.93524 WP_001217074.1.93543 WP_001217074.1.93577 WP_001217074.1.93656 WP_001217074.1.93662 WP_001217074.1.937 WP_001217074.1.93705 WP_001217074.1.93741 WP_001217074.1.93767 WP_001217074.1.9380 WP_001217074.1.93804 WP_001217074.1.93809 WP_001217074.1.9389 WP_001217074.1.93937 WP_001217074.1.93986 WP_001217074.1.93994 WP_001217074.1.94072 WP_001217074.1.94167 WP_001217074.1.94168 WP_001217074.1.94181 WP_001217074.1.94198 WP_001217074.1.94352 WP_001217074.1.94354 WP_001217074.1.94380 WP_001217074.1.9440 WP_001217074.1.94412 WP_001217074.1.94458 WP_001217074.1.94473 WP_001217074.1.94584 WP_001217074.1.94598 WP_001217074.1.94649 WP_001217074.1.94655 WP_001217074.1.94669 WP_001217074.1.94670 WP_001217074.1.94722 WP_001217074.1.94785 WP_001217074.1.94835 WP_001217074.1.94967 WP_001217074.1.94987 WP_001217074.1.95051 WP_001217074.1.95085 WP_001217074.1.95136 WP_001217074.1.95152 WP_001217074.1.95248 WP_001217074.1.95249 WP_001217074.1.9527 WP_001217074.1.95277 WP_001217074.1.95282 WP_001217074.1.95298 WP_001217074.1.95388 WP_001217074.1.95404 WP_001217074.1.95434 WP_001217074.1.95447 WP_001217074.1.95546 WP_001217074.1.95558 WP_001217074.1.95607 WP_001217074.1.95630 WP_001217074.1.95656 WP_001217074.1.95670 WP_001217074.1.95691 WP_001217074.1.95701 WP_001217074.1.95744 WP_001217074.1.95757 WP_001217074.1.95826 WP_001217074.1.9586 WP_001217074.1.95866 WP_001217074.1.95911 WP_001217074.1.95939 WP_001217074.1.95963 WP_001217074.1.96004 WP_001217074.1.96107 WP_001217074.1.96139 WP_001217074.1.96162 WP_001217074.1.9624 WP_001217074.1.96317 WP_001217074.1.96340 WP_001217074.1.96343 WP_001217074.1.96348 WP_001217074.1.96349 WP_001217074.1.96380 WP_001217074.1.96429 WP_001217074.1.9644 WP_001217074.1.96469 WP_001217074.1.96490 WP_001217074.1.96500 WP_001217074.1.96521 WP_001217074.1.96537 WP_001217074.1.96555 WP_001217074.1.96563 WP_001217074.1.96584 WP_001217074.1.96588 WP_001217074.1.96600 WP_001217074.1.96735 WP_001217074.1.9674 WP_001217074.1.96771 WP_001217074.1.96876 WP_001217074.1.96890 WP_001217074.1.96902 WP_001217074.1.96993 WP_001217074.1.97047 WP_001217074.1.97089 WP_001217074.1.97103 WP_001217074.1.97143 WP_001217074.1.97145 WP_001217074.1.97224 WP_001217074.1.97297 WP_001217074.1.97318 WP_001217074.1.97322 WP_001217074.1.97328 WP_001217074.1.97369 WP_001217074.1.97386 WP_001217074.1.97413 WP_001217074.1.97477 WP_001217074.1.97487 WP_001217074.1.97547 WP_001217074.1.97613 WP_001217074.1.97620 WP_001217074.1.97631 WP_001217074.1.97648 WP_001217074.1.97656 WP_001217074.1.97691 WP_001217074.1.97704 WP_001217074.1.97732 WP_001217074.1.97736 WP_001217074.1.9774 WP_001217074.1.9775 WP_001217074.1.97846 WP_001217074.1.9793 WP_001217074.1.97981 WP_001217074.1.9799 WP_001217074.1.97991 WP_001217074.1.98006 WP_001217074.1.98019 WP_001217074.1.98022 WP_001217074.1.98107 WP_001217074.1.98110 WP_001217074.1.98119 WP_001217074.1.98146 WP_001217074.1.98170 WP_001217074.1.98219 WP_001217074.1.98250 WP_001217074.1.9826 WP_001217074.1.98314 WP_001217074.1.98338 WP_001217074.1.98402 WP_001217074.1.9841 WP_001217074.1.98440 WP_001217074.1.98446 WP_001217074.1.98472 WP_001217074.1.98531 WP_001217074.1.98570 WP_001217074.1.98577 WP_001217074.1.98677 WP_001217074.1.98726 WP_001217074.1.98751 WP_001217074.1.98779 WP_001217074.1.98843 WP_001217074.1.9899 WP_001217074.1.99057 WP_001217074.1.99097 WP_001217074.1.99098 WP_001217074.1.99164 WP_001217074.1.99184 WP_001217074.1.99197 WP_001217074.1.99215 WP_001217074.1.99276 WP_001217074.1.99339 WP_001217074.1.99456 WP_001217074.1.99469 WP_001217074.1.99490 WP_001217074.1.99493 WP_001217074.1.99577 WP_001217074.1.99613 WP_001217074.1.99626 WP_001217074.1.99630 WP_001217074.1.99646 WP_001217074.1.99657 WP_001217074.1.99660 WP_001217074.1.99712 WP_001217074.1.99824 WP_001217074.1.99858 WP_001217074.1.99889 WP_001217074.1.99924 WP_001217074.1.99958 WP_001217074.1.99961 gi|378453242|ref|YP_005240602.1| gi|409247971|ref|YP_006888663.1| gi|378702138|ref|YP_005184096.1| gi|559996977|ref|YP_008250935.2| gi|207859449|ref|YP_002246100.1| APC25563 gi|378447614|ref|YP_005235246.1| ABEL01000009|CDS_139123-138362 AE006468|CDS_4538399-4537638 AM933172|CDS_4395637-4394876 CP000886|CDS_4464354-4463593 CP001363|CDS_4551941-4551180 FN424405|CDS_4561098-4560337 gi|538364878|ref|YP_008508163.1| gi|550903639|ref|YP_008672731.1| gi|549726809|ref|YP_008646999.1| gi|161617438|ref|YP_001591403.1| gi|525815584|ref|YP_008245602.1| gi|379703537|ref|YP_005245265.1| gi|16767545|ref|NP_463160.1| 272994.SPAB_05295 550537.SEN4066 99287.STM4295 gi|378991563|ref|YP_005254727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]