SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|207855754|ref|YP_002242405.1| from Salmonella enterica subsp. enterica serovar Enteritidis str. P125109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|207855754|ref|YP_002242405.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.49e-51
Family PP-loop ATPase 0.0000000639
Further Details:      
 
Domain Number 2 Region: 291-401
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.28e-32
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.00000532
Further Details:      
 
Domain Number 3 Region: 201-286
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 5.89e-28
Family MesJ substrate recognition domain-like 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|207855754|ref|YP_002242405.1|
Sequence length 403
Comment tRNA(Ile)-lysidine synthetase [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109]
Sequence
MLLHQLVLWLERHPDVTLRAIHIHHGLSPHAESWVRHCETVCARWQVPLVVERVTLADNG
LGIEAHAREARYRAFAQTLLPGEVLATAQHLDDQCETFLLALKRGSGPAGLSAMGERSPF
AGTLLLRPLLRETRKTLEQWAVRHGLCWIEDESNQDDAYDRNFLRLRALPLLQQRWPHFP
AAVARSATLCAEQERLLDELLASDLTDCITTEGTLRLSPLMSMSDVRRAAILRRWLAMRN
APMPSRDALERIWQEVALARDDASPCLRFGDHEIRRYQSQLWWIKSVAGQHETTVAWPVW
QTPLALPAGLGTVQLVPGGELRRPREEESVSIRFKAPGLLHIVGRHGGRKLKKIWQEQGI
PPWRRDTTPLLFYGETLIAAAGVFVTREGAAEDKEGVSLVWHA
Download sequence
Identical sequences AM933172|CDS_283766-284977 gi|207855754|ref|YP_002242405.1| 550537.SEN0243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]