SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212217701|ref|YP_002304488.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212217701|ref|YP_002304488.1|
Domain Number 1 Region: 28-199
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.75e-37
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212217701|ref|YP_002304488.1|
Sequence length 238
Comment ribosomal-protein-serine acetyltransferase [Coxiella burnetii CbuK_Q154]
Sequence
MNWKNEFNQSVGVPTNCQLPLPRPRGAVLAGRYCVLEPLEVNKHAALLFDSLSIDNRGES
WTYLPYGPFEDGEAFQEWARKLISDEDVLLYAILNAKTQRPVGVAGYLRINPAHGLIEIG
HLHFSTLLRRTPAATEALYLMIRYVFEEIKYRRCEWKCHWLNEPSRRAALRLGFKFEGVF
RQHQVVKGRNRDTAWFSIIDGEWPPIKTNIEKWLNPLNFDLEGKQIISLRELSSSRGE
Download sequence
Identical sequences A0A2K2DYE6 A9KBU2 Q83AH9
gi|212211685|ref|YP_002302621.1| gi|212217701|ref|YP_002304488.1| gi|154706755|ref|YP_001423637.1| NP_820884.1.72601 WP_005769964.1.15899 WP_005769964.1.18990 WP_005769964.1.20088 WP_005769964.1.25364 WP_005769964.1.29693 WP_005769964.1.31144 WP_005769964.1.35092 WP_005769964.1.38839 WP_005769964.1.39746 WP_005769964.1.41753 WP_005769964.1.43615 WP_005769964.1.44545 WP_005769964.1.53098 WP_005769964.1.55037 WP_005769964.1.55635 WP_005769964.1.56161 WP_005769964.1.6787 WP_005769964.1.68745 WP_005769964.1.68840 WP_005769964.1.72017 WP_005769964.1.7296 WP_005769964.1.73073 WP_005769964.1.74283 WP_005769964.1.85884 WP_005769964.1.88235 WP_005769964.1.8942 WP_005769964.1.92481 WP_005769964.1.96664 WP_005769964.1.9866 WP_005769964.1.99156 227377.CBU_1907 360115.COXBURSA331_A2112 434922.CBUD_0212 434923.CbuG_0017 434924.CbuK_0015 gi|29655192|ref|NP_820884.1| gi|161830631|ref|YP_001597726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]