SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212217774|ref|YP_002304561.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212217774|ref|YP_002304561.1|
Domain Number 1 Region: 14-132
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.38e-26
Family N-acetyl transferase, NAT 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212217774|ref|YP_002304561.1|
Sequence length 153
Comment acetyltransferase [Coxiella burnetii CbuK_Q154]
Sequence
MKNYYFSNSKRLLKKNKEKVCRLLKDCFWSKDIPIEYVERFIEHSFCFGIYEEDSEQLVG
FGRVISDYTTYAYICDVVIDPRYRRNGLGKALIDEMFSHPKLQGLKTWSLRTTEEARKIY
EKKGFRIAKHPETLMEIDNLEIYTTVTHGKAEI
Download sequence
Identical sequences A9KEX2
434922.CBUD_0028 434924.CbuK_0095 gi|212217774|ref|YP_002304561.1| gi|154707564|ref|YP_001423464.1| WP_005770117.1.29693 WP_005770117.1.35092 WP_005770117.1.43615 WP_005770117.1.55037 WP_005770117.1.85884 WP_005770117.1.99156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]