SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212218028|ref|YP_002304815.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212218028|ref|YP_002304815.1|
Domain Number 1 Region: 205-365
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000671
Family N-acetyl transferase, NAT 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212218028|ref|YP_002304815.1|
Sequence length 388
Comment hypothetical membrane-associated protein [Coxiella burnetii CbuK_Q154]
Sequence
MLNYQESQMKKKIEILERDDILNDKEFCNKYKSHFALALLLRGSEFFVKNIKTKIFLIKC
DDHIIPCTLNNTEYNNAVNCSPHTSFVSYPKLELKKTKRLPIVFLRIILSLFDMITKLFK
FNRVIQVNNFLSINDRQPAWLSEYLPEITKILTSKYPTHAIYIPRVFNFTSNFLYKNLLF
NNYKCLPIAVAYFFDFRKSTKTKFRLKRDHRRDLKTLNTSTYKAISLENPTQAQIRRAHE
LYQLIYLDKHARFNPDYTVNYFEWHMKSKNHIFLGLLNQKIDAFICLRIMNNLATAAPGG
YDSNLSQNLNLYRQQNALTIEYTKAKNYLLNLGPGVDRFKLNRGGIPVFQYSAVYFHHLS
FARKIPWFLLQRALKFMTIERYLKVVSK
Download sequence
Identical sequences 434924.CbuK_0379 gi|212218028|ref|YP_002304815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]