SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212218031|ref|YP_002304818.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212218031|ref|YP_002304818.1|
Domain Number 1 Region: 199-359
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000403
Family N-acetyl transferase, NAT 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212218031|ref|YP_002304818.1|
Sequence length 381
Comment hypothetical membrane-associated protein [Coxiella burnetii CbuK_Q154]
Sequence
MEKATHPITVFTPKDADRFLEEHREKTGSIEAILLKNDLSLFVTNLKAGRVILSNGSVSI
LATLNKAKCENTHICSPYNAYITYAKAYADHFNSLWAKLLIITFTKMFGKLFQWTKIDKI
IQLNNTISTINLHSTDLSALIPDIVLKLKKRYPKYTIMVLRLNQIMDSTLFTALKNGGFV
LIPTKMVHIYDPEDNYLSKRNVKADLSLLKKRPYQIVYHDELSSEDIKRIRELYEMLFIK
KHSRYAPDLTIHYFQQCYQHRWFEFIALRNQSGIIDAFISYARMNGGMICGPLGYDTTKP
REMGLLRMIISLSLDRAKKTGSIYNLGSGNEKFKLMRGSHREIEYNAIYYQHLPFYRQLP
WKIIAWFSNRFLVKLFKKHLI
Download sequence
Identical sequences 434924.CbuK_0383 gi|212218031|ref|YP_002304818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]