SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212218886|ref|YP_002305673.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212218886|ref|YP_002305673.1|
Domain Number 1 Region: 15-181
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.47e-42
Family N-acetyl transferase, NAT 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212218886|ref|YP_002305673.1|
Sequence length 205
Comment ribosomal-protein-alanine acetyltransferase [Coxiella burnetii CbuK_Q154]
Sequence
MLNAFYSSKFPILNVDDTFFLREQMIKDVEAFFEYYADPDVAHYILASNPRNLAEAAAEI
TYCHDLFKYRRGIYWTLARKEDDRMIGAIGLYINNQHYRAEICYDLSKHYWNRGIMTKAL
QVVVDFCFSRIALNRIEAVTLKENAASIAMLKKAGFAHEGSLKNYRYYKGRSHDIEMFAI
TPEMSSNQKLEKTWARHENFLNLDL
Download sequence
Identical sequences WP_005771239.1.25364 WP_005771239.1.35092 WP_005771239.1.85884 gi|212218886|ref|YP_002305673.1| 434924.CbuK_1351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]