SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212219163|ref|YP_002305950.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212219163|ref|YP_002305950.1|
Domain Number 1 Region: 313-450
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.26e-21
Family N-acetyl transferase, NAT 0.011
Further Details:      
 
Domain Number 2 Region: 24-281
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.42e-21
Family APH phosphotransferases 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212219163|ref|YP_002305950.1|
Sequence length 468
Comment hydroxyurea phosphotransferase [Coxiella burnetii CbuK_Q154]
Sequence
MNMKTLETNAINVWGENGKSWLNQLPGIIKQLSDYWSLRGIQPIDNMSYNYVAKAVQNDQ
SPVVLKISCDKQLIENESRALKSFNGQGSVRMLDMHHELNALLLEQAIPGNLLKSDYPGN
IKNTIKVYAGVVNALASCPEPSDEHTHVSKWCEALDRINDDQIRPHFIRKAKVLRDFLLS
SATTEYLCHADLHLENIINHGNRWLSIDPKGIIGEMAFEAAAFDFIDQNEWSEPDTIQDK
IITRVSLLANVLAIDQERLFAWVFLRAIISAQWFIEDNGDPAEMLNLASVIDPLLTRPSV
SEAAHKPEIKVDELTFKNALPNDLKILNALIRQSKAHWGYSKAFMDKFMLLFKITEEYLA
KNTVKVMLAKNKIVGICGFKRHTNKVLELDYFFIHPDYIGQGLGKKLWGFSCKLAEKLTA
HSFIVWSDPETEAFYIKMGCVKIGMKKSPLLPNRKTPVLEYRLNGDHA
Download sequence
Identical sequences WP_005771960.1.25364 WP_005771960.1.35092 WP_005771960.1.513 WP_005771960.1.7296 WP_005771960.1.85884 434924.CbuK_1661 gi|212219163|ref|YP_002305950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]