SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212219441|ref|YP_002306228.1| from Coxiella burnetii CbuK_Q154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212219441|ref|YP_002306228.1|
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000089
Family HLH, helix-loop-helix DNA-binding domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|212219441|ref|YP_002306228.1|
Domain Number - Region: 161-242
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00222
Family HLH, helix-loop-helix DNA-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212219441|ref|YP_002306228.1|
Sequence length 329
Comment hypothetical transcriptional regulatory protein [Coxiella burnetii CbuK_Q154]
Sequence
MRHENPHYSNEIKFDDSEQNKKMKKRKISPEERKAKHKATEAQRREHISESFDALFQSLS
KKDTEVSDLKGKKVKKEIKTEKEIKILNLACITIEDLKKKLSIDGKNATQDRETSENNQE
NETKVSKKKIDVTLSQSLGKAPEEGEGQAIRKQTISAHPKEIELRPPTVLGHREKEKQIR
ENKRRYVNRLYNLIPRNYFENENKYSKKAQVPYSYIQIFGAAKQYIEKLKLLVKTTENSV
QSLSSPITVSSDQPFTFNFSNQPSSEFSSSYSLQSGNIEPESPLSSRNPFRFFEDKNPSE
EMLPWQETSYDSLTAIDEEEIDGQTRAFQ
Download sequence
Identical sequences gi|212219441|ref|YP_002306228.1| WP_005769368.1.25364 WP_005769368.1.35092 WP_005769368.1.85884 434924.CbuK_1976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]