SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000597 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000597
Domain Number 1 Region: 205-306
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-29
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 2 Region: 61-113
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000906
Family L27 domain 0.0012
Further Details:      
 
Domain Number 3 Region: 132-221
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000473
Family PDZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000597   Gene: ENSGACG00000000468   Transcript: ENSGACT00000000597
Sequence length 323
Comment pep:novel scaffold:BROADS1:scaffold_80:292564:299511:1 gene:ENSGACG00000000468 transcript:ENSGACT00000000597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVASTRTEPVPQMLDAMSDSTTSSTTANDLDLIFLKGIMESPLEQEESLKEPRPAPVRE
NNVELLQEILRDLNPFTGDSDTAAELARILTQPHFQSLLETHDTVASQACDSPPLSPCHF
VDHEQEDGPTPNLPPPPDAVRMVGIRKVSGEHLGVTFKVEGGELIIARILHGMVDQQGLL
HVGDVIKEVNGREVGQDASVLQEELQAASGSVVLKILPSYHEAIQPSQLFFKCHYDYDPA
NDNLIPCKEAGLRFEAGDILQIVNQDDVNWWQARHVEGGSAGLIPSQMLEEKRKAFVKRD
VELAPAAGGVACAVQTEKVRERE
Download sequence
Identical sequences G3N5M4
ENSGACP00000000597 69293.ENSGACP00000000597 ENSGACP00000000597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]