SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000546 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000546
Domain Number 1 Region: 106-322
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-49
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 447-522
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-17
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 313-479
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000546   Gene: ENSGACG00000000422   Transcript: ENSGACT00000000546
Sequence length 558
Comment pep:novel scaffold:BROADS1:scaffold_119:266468:281475:1 gene:ENSGACG00000000422 transcript:ENSGACT00000000546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQRPSSHGADQDNANLRLPSNGAGSQTICHSLNIIKNIAFLYQEYRDTSKQQEIEQRR
QRENLSPEVPPGTLMDGSGVLSPPVLQLQLRNNAQSLSLWQNLEVVQASGLLTRLPQSEI
IMQEAMFELVTSEASYYKSLEILETHFLRNPDLINTLSQSDVHFLFSNIEEVMKASERFL
MDLEHRMEKSILISEVCDIVYHHAVEHFNVFIKYVINQVYQEKNYRRILEGNQAFREAMA
SLENHPRVRGLSFTSFLILPFQRITRLKLLVQNILKKAEENSEIEQNAIKAHQQLEQIVK
ECNEGVRKMSRTEELISIEKTLEFKSKSVPIISHSRWLLKKGEVQHMTGPKTSRTMRSRK
LYQPVYLFLFNNLLLVTKRSSSGDKFQVIDSCTRAMLRTEDLEDQGQLLANVFNLKLLEN
QEERAVNYMLKTSSMSEKLRWTCALTPNRRTRFMSTSAHQQDSPQVQCIHSYSSQEPDEL
SIETADVLNLLERTDDGWMMGERLHDGERGWFPCRLVEDILSKEVRAQNLREAFRIQQAQ
KGGGVLQTEARIGSRAAR
Download sequence
Identical sequences G3N5H3
ENSGACP00000000546 ENSGACP00000000546 69293.ENSGACP00000000546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]