SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000586 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000586
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-30
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 14-64
Classification Level Classification E-value
Superfamily L27 domain 2.06e-20
Family L27 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000586   Gene: ENSGACG00000000458   Transcript: ENSGACT00000000586
Sequence length 208
Comment pep:novel scaffold:BROADS1:scaffold_80:222212:227398:1 gene:ENSGACG00000000458 transcript:ENSGACT00000000586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALAEPLCLERVDVCRVIELLDRLQRSGELPPPKLQALQRVLQSKFCAAIREVYEQLYD
TLDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNIMGGKEQNSPIYI
SRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPKVLE
EMEARFEKMRSARRRQQHTSYSSLESRG
Download sequence
Identical sequences G3N5L3
ENSGACP00000000586 ENSGACP00000000586 69293.ENSGACP00000000586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]