SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000775 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000775
Domain Number 1 Region: 642-897
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000412
Further Details:      
 
Domain Number 2 Region: 29-288
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-53
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 3 Region: 341-579
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-52
Family YWTD domain 0.00000377
Further Details:      
 
Domain Number 4 Region: 945-1206
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-39
Family YWTD domain 0.0000512
Further Details:      
 
Domain Number 5 Region: 1334-1370
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 1256-1296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000101
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 900-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.019
Further Details:      
 
Domain Number 8 Region: 1297-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 598-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000995
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 10 Region: 296-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000536
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1214-1266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000377
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000775   Gene: ENSGACG00000000598   Transcript: ENSGACT00000000775
Sequence length 1630
Comment pep:novel scaffold:BROADS1:scaffold_90:127158:140879:1 gene:ENSGACG00000000598 transcript:ENSGACT00000000775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSRGSSPPPPPLLILLILFVCLPLSGVPLLLYANRRDLRLVDAAHEKTNATVVVGGLED
AAAVDYVYSQGLIYWSDVSEEAIKRTVFNQSGASAVQTVVPGLASPDGLACDWLGSKLYW
TDSETNRIEVAELDGSSRKVLFWQELDQPRAIALDPERGYMYWTDWGEVPKIERAGMDGT
NRSVIVDQEIYWPNGLTLDYGPGKLYWADAKHNFIHRADLDGSSRESVVKGELPHPFALT
LYEDTLFWTDWSTHSIHSCRKQTGDEQRVVHSHILSPMDIHVFSAKRQATVVSSHCSVNN
GGCSHLCLLSPMKPFYLCACPTGVQLLEDGKTCRDGATRMLLLARRTDLRHISLDTPDFT
DVVLQVEDIRHAIAVDYDPVEGYVYWTDDEVKAIRRSRLDGADAQFLVTSQVNHPDGIAV
DWIARNLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPK
IERANLDGTERLVMVNTSLGWPNGLALDYEERKLYWGDAKTDKIEVMDMDGTGRRVLVED
MLPHIFGFSLLGDFIYWTDWQRRSIERVHKRTAEREVIIDQLPDLMGLKATHVHESSGTN
PCAESNGGCSHLCLYKPQAVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETN
NNNVAIPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGM
AVDWLGKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGK
PKIDRAAMDGTGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIAD
DLPHPFGLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQGGW
NACASTNGHCSHLCLAVPVSGFVCGCPAHFSLNYDNKTCSAPTSFLLFSQKTAINRMVMD
EQQSPDIILPIHSLRNVRAIDYDPLDKHLYWIDSKQGVIRRALEDGNQSSTVVSSAAPGP
GPGLQLYDLSIDIYSRFIYWTSEVTNVINVTRTDGGRVGVVLRGEQDKPRAIVVNPERGY
MYFTNLLDRSPKIERAALDGTEREVLFFSGLGKPVALAVDNEVGRLFWVDSDLRRIESSD
LSGANRIVIADSNILQPVGLTVFGEHLYWIDKQQQMIERIDKTTREGRTKIQARIAYLSD
IHAVHELDMREYGKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQNELSCGEPPTCS
PEQFSCTSGEVDCIPQAWRCDGYPECDDGSDEEDCPVCSEDEFQCDSRQCVDLRLRCNGE
VNCQDRSDESKCEVRCPPDQFSCSSGQCIGKHKKCDHNTDCADNSDEIGCYGNKNPTEEP
PPPSNNTIGSIVGVVMALFVVGAVYFACQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYV
PHPASLSSSLPAGMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGAYFPPIL
NPPPSPATVRSQYTMEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGR
RAPLRSAGIAKGYASDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYP
PPPSPCTDSS
Download sequence
Identical sequences G3N651
69293.ENSGACP00000000775 ENSGACP00000000775 ENSGACP00000000775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]