SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002195 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002195
Domain Number 1 Region: 364-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.44e-55
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 202-347
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-28
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 128-217
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.00083
Further Details:      
 
Domain Number 4 Region: 68-119
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000836
Family L27 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002195   Gene: ENSGACG00000001679   Transcript: ENSGACT00000002201
Sequence length 573
Comment pep:novel group:BROADS1:groupXXI:614128:678875:1 gene:ENSGACG00000001679 transcript:ENSGACT00000002201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAPLPPSAGLYDLLAALPSQLQPHVSRSEDNTFLQNMFGERSLQTLVKIHEQLQFYEER
KPVPVLDSAAALAHELSDEMEGKSANREIKELLQLLGRPHVKSLLLVHDTIAQKSYDPEL
PPLPDDIDDNEDSVKIIRLVKNKEPLGATIRRDDLTGAIVVARIMRGGAADRSGLIHVGD
ELKEVNGIPVDDKKPEEIIRLLAQSQGAITFKVIPSVKEEEPTKEPKVFMKALFDYDPKD
DKAIPCMEAGLAFKRGSILQIMSQDDATWWQAKHEGEANPRAGLIPSKQFQERRFALRRP
DATLPLQRTSSRRSSGFRRSFRLSRRDKKTNKSMYECKKSEIYDTADLPTYEEVTTYRRP
SGAKHRLAVLVGPPGVGLNELKRKLLISDPQHFSVTVPHTSRAKRNQESDGVEYHFISKH
LFETDIHNNKFIEYGEYKGNYYGTAIDSVRSVLSRNKVCLLDVQPHTIKLLRTAEFKPFV
VLVKPPAIERLRETRMNAKIISGKDDKGSAKPFTEEDFQEMVTTAQTLEVQHGHLFEKII
VNDDLSTAFGELRGALKTVETETHWLPVSWTHS
Download sequence
Identical sequences G3NA53
69293.ENSGACP00000002195 ENSGACP00000002195 ENSGACP00000002195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]