SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002456 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002456
Domain Number 1 Region: 463-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-53
Family Nucleotide and nucleoside kinases 0.00017
Further Details:      
 
Domain Number 2 Region: 308-449
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-28
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 108-165
Classification Level Classification E-value
Superfamily L27 domain 3.41e-20
Family L27 domain 0.00064
Further Details:      
 
Domain Number 4 Region: 240-324
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-18
Family PDZ domain 0.0000688
Further Details:      
 
Domain Number 5 Region: 173-223
Classification Level Classification E-value
Superfamily L27 domain 0.0000177
Family L27 domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002456   Gene: ENSGACG00000001891   Transcript: ENSGACT00000002464
Sequence length 662
Comment pep:novel scaffold:BROADS1:scaffold_128:10169:21859:1 gene:ENSGACG00000001891 transcript:ENSGACT00000002464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSHLNGHVTEEPRGGQQHREMAVDCPGELGSRTLPIRRSTQLERIRQHQEDLRRRREE
EGRQLDLNASLRLRKLSQHPHIGIDNPTFLQDSHTSQQLPLSIQHTHALLELEELLLSLK
QVRGSLSDQQSQNDVELVLALLNKSDFQSALKIHNAVATSMHRPSPPYPHTQQALQLALE
TRSLIQSSQNKEGLELHRLLSDTHIQQSLLLAHDSIAETEMQLEPLPSEGETLTQWGGET
VKIVRIEKAQDVPLGATVRNEMESVVISRIVRGGAAERSGLLSEGDEVLEINGVEIRGKD
VNQVFDILADMHGLLTFVLIPSTQSKPPPVKESVIHVKAHFDYDPSDDPYVPCRELGLSF
QKGDILHIISQSDPNWWQAYRDGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKTG
KLWCAKKNKRKRKKLLYNTNRNDDLDNEEVLTYEEMALYHQPANRKRPIALIGPASCGQA
ELRQRLLNSQPERFAGAVPHTTRSRRDCELSGRDYHFVSRQTFEAELAAGKLIESGDFEK
NLYGTSTDSVRQVINTGKICVLCLHTQALKVLRSSDLKPYIIFIAPPSQERLRALLAKDN
KNPKPEELRDVIEKAREMEQSCGHLFDGVITNTDQDKAFNELLRLINKLDTEPQWVPCSW
LR
Download sequence
Identical sequences G3NAW0
69293.ENSGACP00000002456 ENSGACP00000002456 ENSGACP00000002456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]