SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003850 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003850
Domain Number 1 Region: 181-276
Classification Level Classification E-value
Superfamily TAFH domain-like 5.49e-31
Family TAFH domain-like 0.0000385
Further Details:      
 
Domain Number 2 Region: 454-502
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000014
Family TBP-associated factors, TAFs 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003850   Gene: ENSGACG00000002940   Transcript: ENSGACT00000003863
Sequence length 668
Comment pep:novel group:BROADS1:groupVIII:206699:216408:1 gene:ENSGACG00000002940 transcript:ENSGACT00000003863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGSQTVPVAPRLPHTGPPQLPANIQIPPGMMLIRSDSGQLMLVSQQALAQAQQAPRGVC
GQAPRILIPQVSSAAGNKNHEKVTVIRMTAPPAFHPAPVQKTAVVKVHQLACTPQTNTAG
QVLFGDKPFYLIVQVNGETPKPAVVQALSAVSDRGSQPLVHTVITEPKKETAASVSQQAT
LESVKKCKNFLVTLIKLASSDSRSANMANNVRGLVRSLLEGKLEAEEFTEQLYRELKSTP
QPCLVPFLKKSLPAVRRLTADPHLFIQQASTSTGNLTKPPSSTTTGQPFSTSQQTLGAPS
TLTNCTSXRRRSFLHPTHTNSGLQRPTKNWQLIKQPPGVTLRPGMTTLVQSRNYILKSSR
PIPKQVVVQSGKPLAGTVVIKTTFHSGTTSFYQICIQGQFRIVQCVCFPPPPLHREDDDI
NDVASMAGVNLREENARILTSGVGSVVQSCQDQLFLSPSLVLSRILLSGRAFAVTDVGPN
VVALVSHATQECLRGLLEKLTVMAEHRKAGLKEDLWHAKVSDVRSQLRFLEEVESLKKKR
RDEEEREHMLRLARSRSHTEDPHQQQLKQRAKELQQMEEAQLQQREANLAALAAIGPRKK
RPLEPNASQKKSGLQGVGYATALQAVGVTLLPRPAVERVTRVMLRDLLLCMEQHHFLCHS
LSLYRAML
Download sequence
Identical sequences G3NEU9
ENSGACP00000003850 ENSGACP00000003850 69293.ENSGACP00000003850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]