SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000004171 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000004171
Domain Number 1 Region: 20-88
Classification Level Classification E-value
Superfamily PH domain-like 0.00000091
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000004171   Gene: ENSGACG00000003185   Transcript: ENSGACT00000004185
Sequence length 369
Comment pep:novel group:BROADS1:groupXX:493566:512998:-1 gene:ENSGACG00000003185 transcript:ENSGACT00000004185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKSSSGKRGPQDLAPQQVQPDKVGWIRKFCGKGIFREIWKNRFMVLRGDQLFVCEKEQV
KEMGRSDEVLDLCDYERCEEIRKKKSRSKKNHSEFRLQRRSSPGIECEASVDEQKQLINA
QQRKRIKALNGPSVDVSVVSEVTVEDSQLSHLTRDRVKIPQNRRLPTRGHLLAVASSSSD
GMLTLDLIQEDDAHPHLGPDCPRSKTDGALSAEASGKSQSLPREVAWEKTGQTPQTGKLL
TPAEKNRCASMDEILAHSEAKGAAREGNAAMSRTSVTRLQELISQKLEETERLLTEVQAE
AKERGRGSGEESTEAERLLREAEVTWSRARDVLEEVKELRELYRQLDSSSTPPILPQTEP
GLEERHVGR
Download sequence
Identical sequences G3NFR6
ENSGACP00000004171 ENSGACP00000004171 69293.ENSGACP00000004171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]