SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009088 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009088
Domain Number 1 Region: 333-535
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.2e-56
Family Nucleotide and nucleoside kinases 0.0000188
Further Details:      
 
Domain Number 2 Region: 193-322
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-33
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 125-210
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-16
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 4 Region: 54-107
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000824
Family L27 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009088   Gene: ENSGACG00000006849   Transcript: ENSGACT00000009108
Sequence length 539
Comment pep:novel group:BROADS1:groupX:9509713:9515132:-1 gene:ENSGACG00000006849 transcript:ENSGACT00000009108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLDNLSELPTSTGAKDIDLLFLRGIMESPTVRSLDKAHEQLEEVKLEAVQDNNVELV
TDILGDISNLQVKDDSAAELSRILKEPHFQSLLEAHDMVASKCYEVPPPTEPTNDAAVNS
ALMQADAVRMIGIRKKAGEPLGVTFRVEKDDLVIARILHGAMIDRQGLLHVGDIIKEVNG
KDVGNNPTELQEMLKDCSGGITLKILPSYRDAPAPPQVYVRPYFDYDPAHDSLIPCREAG
MGFKKGDILQIVNREDPNWWQACHVVAGATGLIPSQFLEEKRKAFVPRDFDGSGILCGTI
AGKKKKKMMYLTAKNAEFDRHELQIYEEVAKVPAFQRKTLVLIGAQGVGRRSLKNRLMVL
QPTRFGTTMPYTSRRPRDDELDGNSYHFTSRTEMEADVKAGRFLEHGEYDGNLYGTKIES
IHEVVGTGRTCILDVNPQALKVLKTAEFMPYVVFIAAPDFDTLKAMHKAVVDAGITSKQL
TDVDLKKTVDESARIQRAYSHYFDLTIVNDNLDKAFETLHAGVDKLCSEPQWVPVNWVY
Download sequence
Identical sequences G3NUR9
ENSGACP00000009088 69293.ENSGACP00000009088 ENSGACP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]