SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009149 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009149
Domain Number 1 Region: 373-570
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-44
Family Nucleotide and nucleoside kinases 0.00021
Further Details:      
 
Domain Number 2 Region: 203-302
Classification Level Classification E-value
Superfamily SH3-domain 6.56e-23
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 132-216
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000165
Family L27 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009149   Gene: ENSGACG00000006899   Transcript: ENSGACT00000009169
Sequence length 574
Comment pep:novel group:BROADS1:groupV:9196696:9202051:1 gene:ENSGACG00000006899 transcript:ENSGACT00000009169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIVSTSTGLHETLAHLTSRLHSGAKHKEELGFLTDVFSEKSLGYLMKIHEKLKQYEKHS
PSPVLHSATCLAEDLAEELQNGPLEDDERELLLLLSTPHLKAVLSAHDTVAQKKFDPVLP
PLPEDVDDDLEEESVKIVRLVKNKEPLGATIRRDEVTGAVIVARIMRGGAAHRSGLVHVG
DELREVNGNRIAHRRPDEISQILCQSQGSITLKIIPAVVEEDQLKESRVYLRALFDYTPY
EDKATPCQEAGLPFHRGDILQVVSQEDATWWQAKRIGDCNLRAALIPSTQFQERRLRYRM
KMGSSPFGSKASTSWRPAEDCDREGALNGKDMAGSRLRKDRLSSPGEPRAPEATRAEFQI
YEEVTQYMPRPGERPRLIVLIGSLGARITELKQKVIAQNPQLYGLAVPHTTRARRCYERE
GVEYHFINKAAFDAGIQGGKFIEFGEYKDNLYGTSLESIHRTLDQNKVCLVDVQPEAVVT
LRTADFKPYVIFVRPRIDDVQSKSLGSSSSLSSVITEDDLHEMKQSAEQIDACYSSWVDY
VLMKEDPVSALAELQVVLERVQTERQWVPVSWVR
Download sequence
Identical sequences G3NUY0
ENSGACP00000009149 69293.ENSGACP00000009149 ENSGACP00000009149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]