SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010254 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010254
Domain Number 1 Region: 171-259
Classification Level Classification E-value
Superfamily TAFH domain-like 1.23e-34
Family TAFH domain-like 0.0000413
Further Details:      
 
Domain Number 2 Region: 455-502
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000218
Family TBP-associated factors, TAFs 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010254   Gene: ENSGACG00000007729   Transcript: ENSGACT00000010276
Sequence length 666
Comment pep:novel group:BROADS1:groupXIX:8837368:8845492:-1 gene:ENSGACG00000007729 transcript:ENSGACT00000010276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VASSPRAAAPQLAVRPQQQTTIQLPPGFSMPPGMVLVRTETGQLVMVPQQVLAQAQAKTQ
QSQVGANISQRPPTPTAATAIRVSAPPTAPQTVRLAAPNQTRMVQSPSSTTIQKTITVSP
GGAAVSVKMPPAQKAQTVITAGGTPVSKPVCVPSSTTHTPAPTQTNRVTVVSQEMQENVK
KCKNFLATLIKLASHNSPSPDTSKNVKALVQDLLDAKIEPEEFTSRLQAELKSSPQPYLI
PFLKKSLPALRQSLLSSQQSIVTPGTSAPHPVAPGSVTTIRSRMPITPVGGNVRMTPPLT
NTMVVVVLLVKGPVPRTLLSLLMSPAPMLLPQQTTANVRRTDIMTLRGPHVTACLFRRSD
LKVNSLYFSPIDLLLLCTLVRGPTTIIGKSPLNLAAQANQRKLSDPGGGTFRDDDDINDV
ASMAGVNLNEENARILATSSDFVGTKIRSCKDEAFLPTGLLHRRILDTAKKLGVTEVPLE
VVNLVSHATQSRLRSLLEMVSAVAQHRTDGGKEEEQHEQTSDVRSQLRFFEQLERMEKQR
KDEQEREILLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRRK
RRMDSPGGSSSGPEVTPCSGTGSSPRQQLRQRITRVNLRDFIFCLEQDRSTSRSMTLYKA
LLNVTQ
Download sequence
Identical sequences G3NY34
ENSGACP00000010254 69293.ENSGACP00000010254 ENSGACP00000010254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]