SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010466 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010466
Domain Number 1 Region: 423-627
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.61e-57
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 222-332
Classification Level Classification E-value
Superfamily SH3-domain 6.25e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 128-237
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-20
Family PDZ domain 0.0022
Further Details:      
 
Domain Number 4 Region: 96-139
Classification Level Classification E-value
Superfamily L27 domain 0.000000000718
Family L27 domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010466   Gene: ENSGACG00000007889   Transcript: ENSGACT00000010488
Sequence length 633
Comment pep:novel group:BROADS1:groupXVI:15735794:15745166:1 gene:ENSGACG00000007889 transcript:ENSGACT00000010488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIFSSKNNKRQAMEDGEKHTNSHSHTGVTEMLSDVVQDVSHAVCRNIYGSQVLHELLSAP
WLHALLKIYERLLQFERSTPTPVLPYASGLSLEVILTTLQNVHGPSAEARELYSLLSSPH
IQALLSSHDSVAQSDYGPVLAPLPDEMPEGEEAMRIVCLVKNNQPLGATIRRDEDTGEIY
IARVIHGGLADRSRLLHPGDLLVEVNGNPVVGLEPEQIIQILINSQGTILFKVIPEKAQS
NSGQKSVYMRALVDYSPLQDSSIPCPDAGMAFSRGELLEVVDQSDAHWWQARKLPCSTSC
AGLIPSAGMLKSKQREQWWCQPLQVHTCIRPYLSITIPEKDQIQSDEKRTATVSEEFFCS
LPPEKADSDISDGIYLAGFRQSFRLWRRTSYRKRRQSCTSCAPNTSAYSTPYEEVALYQR
PPQEDHRLIVLLGATRVGVNELRKRLIKLNPSTFQGPVPHTTRPIRAGEETGREYHFVTK
ELFEYMVCNHRFVEYGEYKGHLYGTSTDAIDEVLKRGRMCILDVEPHSIQPLRTGKLKPY
VIFIKAPSLDRLRQTRRNARIITNCSVNRAFTEDDFVELEESSRLMEAKYKQFFDEVLVN
DDLQHACVQLCSILQRAQDEPQWIPVSWSRAEE
Download sequence
Identical sequences G3NYP5
ENSGACP00000010466 ENSGACP00000010466 69293.ENSGACP00000010466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]