SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010886 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010886
Domain Number 1 Region: 3-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-75
Family Protein kinases, catalytic subunit 0.00000666
Further Details:      
 
Domain Number 2 Region: 722-906
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.16e-46
Family Nucleotide and nucleoside kinases 0.000000121
Further Details:      
 
Domain Number 3 Region: 585-708
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 324-376
Classification Level Classification E-value
Superfamily L27 domain 5.89e-21
Family L27 domain 0.0000634
Further Details:      
 
Domain Number 5 Region: 458-556
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-20
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 6 Region: 386-437
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000335
Family L27 domain 0.0000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010886   Gene: ENSGACG00000008227   Transcript: ENSGACT00000010909
Sequence length 910
Comment pep:novel group:BROADS1:groupXVI:16096538:16135784:-1 gene:ENSGACG00000008227 transcript:ENSGACT00000010909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPRGPFSEVRRCINRETGQQFAVKIVDVAQFTSSPGLSTEDLKREASICHMLKHPHIVEL
LETYSSDGMLYMVFEYMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNV
IHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYG
KPVDVWGCGVILFILLSGCLPFYGTKERLFEAICRGKYKMNPRQWAQISESAKDLVRRML
MLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNSRRKLKGAVLAAVSSHKF
NSFYGDPPEELHDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQD
QHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENHEAKELRRILTQPHF
MALLQAHDVVAHEVYSDDALRVTPPPTSPYLNGESPESTNGDMDLENVTRVRLVQFQKNT
DEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHIGDEIREINSISVANQTVEQLQKMLR
EMRGSITFKIVPSYRTQGSSCEKESPNTSRQSPANGHSSINSSILDLPSTIQPKGRQIYV
RAQFEYDPSKDELIPCKEAGIRFQVGDIIQIISKDDHNWWQGKLENTKNGTAGLIPSPEL
QEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAF
KRKTLVLLAGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEEDGKNYYFVSHDQM
MQDISNNDYLEYGSHEDAMYGTRLETIRMIHQHGHIAILDVEPHALKVLRTAEFAPYVVF
IAAPTIAPGISEDESLQRLQKESEILQKTYAHCFDQTIINNEIDETIRHLEEAIDLVCTT
SQWVPVSWVY
Download sequence
Identical sequences G3NZW3
ENSGACP00000010886 69293.ENSGACP00000010886 ENSGACP00000010886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]