SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011079 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011079
Domain Number 1 Region: 578-937
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.15e-124
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 85-188
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000767
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011079   Gene: ENSGACG00000008359   Transcript: ENSGACT00000011102
Sequence length 943
Comment pep:novel group:BROADS1:groupXX:9795126:9808047:1 gene:ENSGACG00000008359 transcript:ENSGACT00000011102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAAMGSEERSSAMSQKISSASRSNSSASSKLDSRQKCKSGETASSFLPNVDTFGVVCKMP
VCCNQTPDSWEIVEGLRGGFSSVLEPQKQEGFMLKRRKWPMKGWHKRYFFLDKGILKYGK
CSADIERNKLHGCIDVGLSVMAIKKKAKCIDFDAEENIYHLKIKSQELFDEWVSKLRHHR
LYRQNEIALYPTEKSFYYPHYPSPISSSMAESASIRKVCLLPQCVTTQRQSMGNSAGDFP
PSCHSQAKVAAWLQSSDDMDKCSKDLSVCEAGLLELSHLLQSMEVLHRTYSAPSIQALQA
STFDSPKKEKRLPRKWCTKNYNKDVKSTLQVDFTTINESLQSSTPALLKVPSCISSGSIR
LHASNPNLSTAALANDKADTESVDSTFDVAKLHEDFFRVATNLHLTMKTALSSLTSERER
LKQCVNHETIPPTSPRVVGLKNTLATALAQNYELRERLSKIHAESHILEPTLNLTAPVQK
QDSVDDSRPLVHQISNESGASITESMTEFFDAQEVLLSASSSENEVSEDDSYISDISDNI
SIDNLSNETEGERPNSDTVAEGSVLYQRRSCLPSPSPNNSTISLWNILRNNIGKDLSKVA
MPVQLNEPLNTLQRLCEELEYSELLDKAANTQDPFERMVYIATFVVSGYASSYYRTGGKP
FNPVLGETYECERPDKGLRFVAEQVSHHPPISACHAESKNFLFWQDVRCKNKFWGKSMEI
VPVGTTHVTLPGFGDHYEWNKVTSCIHNILSGQRWIEHYGEISIRNSSSDICQCKITFVK
AKYWNSSGNEVEGAVTDNKGKVVHRLFGKWQEAVFCGDPPSATCVWRANAMPVDLEQYYG
FTKFAIELNELDPSLQLLLPPSDTRLRVDQRLLETGNLEAAEEHKQRIEELQRERRKVLE
ENNETHQPKFFRKSKDDTWVSNNTYWELRKDPGFTQIDFPVLW
Download sequence
Identical sequences G3P0F6
69293.ENSGACP00000011079 ENSGACP00000011079 ENSGACP00000011079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]