SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011141 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011141
Domain Number 1 Region: 343-519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-46
Family Nucleotide and nucleoside kinases 0.0000218
Further Details:      
 
Domain Number 2 Region: 203-333
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-31
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 3 Region: 129-223
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-16
Family PDZ domain 0.00073
Further Details:      
 
Domain Number 4 Region: 66-116
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000235
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011141   Gene: ENSGACG00000008428   Transcript: ENSGACT00000011164
Sequence length 519
Comment pep:novel group:BROADS1:groupXX:9819045:9824874:-1 gene:ENSGACG00000008428 transcript:ENSGACT00000011164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVANAKSGKAMQQVLDNLKYLPSGSGAKDIDLIFLRGIMESPIVLSLTKAHERLEEVKL
KAVREDNVQLVTEILDSLNNLPEEDVAAAELVKILQEPHFKSLIEAHDKVAAKCYEMPHT
AGNSSAFISSSLMPADAVRMIGIQKKAGEPLGVTFRVEQGEMVIARILHGSSIDRQGMLH
TGDIIREVNGCEVSQSPQELQELLGNCTGSVTLKVLPSYRDSPAPPQVYLKPHFNYNPAT
DNLIPCKEAGLAFSKGDILHVVNKEDPNWWQACKVVGGATGLIPSQFLEEKRKAFVRRDL
DTSAAGMICGTAKKKKKKMMYLTSKNADFDRYELQIYEEVAKMPPFQRKTLVLIGAQGVG
RRSLKNRLIVMNPLRYGTTVPFTSRQPREEERDGQNYCFVTREQMEKDVKENRYLEHGEY
DGNLYGTKIDSIHEVVNAGRTCILDVNPQALKLLKTAEFMPFVVFIAAPELDTLRAMHQA
VIDAGLTTKLLTENDLKKTVDESARIRRAYSHYFDRTIV
Download sequence
Identical sequences G3P0L8
ENSGACP00000011141 69293.ENSGACP00000011141 ENSGACP00000011141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]