SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011258 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011258
Domain Number 1 Region: 459-653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.81e-53
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 305-422
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-26
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 3 Region: 235-321
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 4 Region: 114-169
Classification Level Classification E-value
Superfamily L27 domain 5.71e-19
Family L27 domain 0.001
Further Details:      
 
Domain Number 5 Region: 179-226
Classification Level Classification E-value
Superfamily L27 domain 0.0000000004
Family L27 domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011258   Gene: ENSGACG00000008518   Transcript: ENSGACT00000011281
Sequence length 657
Comment pep:novel group:BROADS1:groupXVIII:7983024:7992837:1 gene:ENSGACG00000008518 transcript:ENSGACT00000011281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMSHMNGHVQDASGQAKSHRERAVDCPGDGSRIVKSSNCSAHMERIQHYQEELRKRREE
ESRGKHDIDPNASLRLKKLSQNPMVGIDNPTFEGKEKATKDAFPQDPVAVSTSCSELAEL
LQALKWAHHCLADAQSQQDVELIMQLLSKEDFKNAYTIFIAVSQQMSKVIPTSPLTAQAE
DLCQEVQKILQSSQHKEGLELKALLTNPHLQALMQAHDSVAGQEEPEENLTQYIGETVKL
VRLVKARDTPLGATVRNDMDSVLVSRVVKGGAAEKSGLLSEGDEILEINGISIRGKHVNE
VHDLLQQMQGTLTFLLIPSSQIKPAPHRQTVMHVRAYFDYDPSDDPFLPCRELGLSFQKG
DILHVISQDDPNWWQAYRDGDEDNQPLAGLIPGKCFQQQRETLKKTITDKSQEQQGRLWY
VKKIKRQKRKIMSTSLSRNTDYDDILTYEEMSLYHQPANRKRPIGLIGPTNSGHDNLRRK
FLSIEPEKFAVAVPHTTRIPRIHERNGREYHFVSRSAFETDLAAGKFVESGEYEKNLYGT
STDSVRHVINSGRICLLCLHTRSLQVLRSSNLKPYVIFIAPPSQERLRTLLASDGKTPKV
PAAKDATEKAREMEQTFGHFFDATVVNMDPDQAFHELRRLIDKLDTEPQWVPTSWLC
Download sequence
Identical sequences G3P0Y5
69293.ENSGACP00000011258 ENSGACP00000011258 ENSGACP00000011258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]