SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012589 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012589
Domain Number 1 Region: 382-582
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-48
Family Nucleotide and nucleoside kinases 0.0000896
Further Details:      
 
Domain Number 2 Region: 201-300
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-26
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 132-216
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-20
Family PDZ domain 0.00095
Further Details:      
 
Domain Number 4 Region: 68-117
Classification Level Classification E-value
Superfamily L27 domain 0.000000000247
Family L27 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012589   Gene: ENSGACG00000009540   Transcript: ENSGACT00000012613
Sequence length 586
Comment pep:novel group:BROADS1:groupXI:6833415:6843105:1 gene:ENSGACG00000009540 transcript:ENSGACT00000012613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLTAGAGLHETLALLTSQLRPDANHKEDMVFLKDVFSERSLGCLMKIHEKLRQYERQS
PTPVLYSASSLAEDVAEELHSGPMSTEEKELLHLLTSPHLKAVLSVHDTVRRRTLNPVLP
PLPDLEDELEEESVKIVRLVKNKEPLGATIRRDEATGVVIVARIMRGGAADRSGLVHVGD
ELREVNGVSVIHKRPDEISQLLSQSQGSITLKIIPAIKEEDRLKDSKVYMRALFDYVPLE
DKATPCQEAGLPFKRGDILQVVTQDDHTWWQAKRVGDSNLRAGLVPSKLFQERRLAYRVK
MGTLPNPKSPKNPVYDQGCDKEDCDCEGYFNGQYIAGLRRSFRLSRKDRQGSSGEGSDPG
DSDYLTYEEVTRYQQRPNERPRLVVLIGKQGSLGARINELKQRVIAENPHRFAVAVPHTT
RPKKPHEKEGVEYHFVTKQQFDADALNNKFIEHGEYKENQYGTSIEAIRSVQAKNKMCVV
DVQPEALRRLRTAEFKPYVIFVKPRVPESRRRRSAATSPGGGEHGRITDEDLQEMRQSAA
QIDQQYGHLVDRILVKEDSASACAELRGILERLERESFWVPLSWVR
Download sequence
Identical sequences G3P4R6
ENSGACP00000012589 69293.ENSGACP00000012589 ENSGACP00000012589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]