SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015491 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015491
Domain Number 1 Region: 340-513,548-709
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.69e-91
Family YicI catalytic domain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 113-338
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.35e-38
Family YicI N-terminal domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 714-810
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.73e-16
Family Putative glucosidase YicI, domain 3 0.0035
Further Details:      
 
Domain Number 4 Region: 74-121
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000209
Family Trefoil 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015491   Gene: ENSGACG00000011709   Transcript: ENSGACT00000015522
Sequence length 944
Comment pep:novel group:BROADS1:groupXI:10727745:10734519:1 gene:ENSGACG00000011709 transcript:ENSGACT00000015522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPCDCAVAGLLLVFALSTCFYINHLCVHRTSPVRPDDAKQNRPINIIHLQQNITVETWAA
ARERPKPTALPRGDTCSMAPESRFDCARDRLLSRGECAERGCCYDPLPGSAGPPWCFYPS
LYPGYEMGPLTPTPRGEEASLTRAIPSHLPGDITSLQLEVSEETAGCFHLTLKDPSSPRY
EVKLPPGVPQRKTADKDVLFSTEYQSDPFGFIMRRKSNGRVIVNTTVAPLLFADQYLQMS
TALASPHVSGLGEHYSSLLLDLNWTSLTLWNRDMAPHADANLYGSHPFYIVQEQDGLAHG
VFLLNSNAIEVVLQPTPALTWVAIGGVLDLYVFLGPDPRSVIRQYLRVIGYPMMPPYWSL
GFHLCRWGYTTTATTRRVAQRMRNATFPMDVQWNDLDYANKDRVFTFDPWRFGDLPEMVE
EFHKSGMKYILILDPGISSTSPPGTYFPFDDGLRRDVFIKNATGHILIGKVWPGPTAFPD
FTNPETGRWWEDCIREFHSKVPVDGLWIDMNEPASFVQGSSEGCPDGDLENPPYTPRVVG
GKLNSGTLCMSAQQKLSTHYNLHNMYGLTEACATHSALVKVREKRPFVLSRSSFPGIGRF
SAVWTGDVRSDWEQLRYSIPAVLRFGLFGVPLVGADICGFGGNTNEELCVRWMQLGAFYP
FMRNHNDKSNAPQEPYVFGQKAQAAMRSALNLRYSLLPFLYTLFHHAHTAAATVARPLFM
EFPSDENCRAIDRQFLWGSSLLISPVLERGAVELAAYLPSGTWYSLHNVSRTIQFLFVYC
QKEPRGQPFYSKGQYLLLPAPLDTINAHVREGHIIPQQEPALTSTASRRNPFFLTVALST
GGWAWGDLFWDDGDTLNTFEGGNYCYVIFTAGQSQVVSDPTRLNGALDGLVLGGLQVFGV
PSPPLYVLANGRKVWDFTYRSDTKLLTVTNIALPMSEVFTVQWA
Download sequence
Identical sequences G3PD17
ENSGACP00000015491 69293.ENSGACP00000015491 ENSGACP00000015491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]