SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019801 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019801
Domain Number 1 Region: 373-575
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-56
Family Nucleotide and nucleoside kinases 0.00023
Further Details:      
 
Domain Number 2 Region: 218-328
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-24
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 123-227
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-20
Family PDZ domain 0.002
Further Details:      
 
Domain Number 4 Region: 82-131
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000394
Family L27 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019801   Gene: ENSGACG00000015002   Transcript: ENSGACT00000019839
Sequence length 583
Comment pep:novel scaffold:BROADS1:scaffold_74:413269:421422:1 gene:ENSGACG00000015002 transcript:ENSGACT00000019839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQAVEAQVLNPCCELGEHGLRQILSDVIQEVQWSVNQDIDGAEILHSLLNASWLQSLLK
VYECLQRYLRGSPAPALDYASGLSLQLLADIRALPGCSEEAKELYSLLRKPNLQALLSAH
DTVAQKDYEPVLPPMPDKLPDDEEATRIICLVKNKQPLGATIKRNEITGEIFIARVIHGG
LADRSGLLHAGDRVVEVNGFPVDGLEPEQVIQVVQARSQGTIMFKVIPITERPVHNQTML
YVRALVDYSPQQDPAIPCADAGVSFRKGDVLEIVDQTDALWWQAKKLPSSSACAGLVPSS
NLLRRLCVCLPAECQRSSEKDFSAGFRRSLRLCRRRSHSTTQPSCHTRCPSSCSNSLGSP
YEEVVRYQRHPQDAHRLIALLGPPGVGVNELRRRLIELNPNLFLGAVPHTTRAPKGYEES
GREYYFISRETFGNMVYNNRFLDYGEYRGNLYGTSIESVRDVLLSGKICVMDIDPNAIHA
VRSHELKAYIIYVKPPSQDRLKETRQDSYITTNYYINRPFKEEDFQEMEEAARKIESHYW
AFFDQVIVNDRLQDSCVQLLTAVRKAQDEPQWVPASWIRPTTT
Download sequence
Identical sequences G3PQB6
69293.ENSGACP00000019801 ENSGACP00000019801 ENSGACP00000019801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]