SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020449 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020449
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-29
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020449   Gene: ENSGACG00000015500   Transcript: ENSGACT00000020488
Sequence length 201
Comment pep:novel group:BROADS1:groupII:8656387:8658336:-1 gene:ENSGACG00000015500 transcript:ENSGACT00000020488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGEPVRLERDINRAVELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPAGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQNNFPQ
Download sequence
Identical sequences G3PS63
69293.ENSGACP00000020449 ENSGACP00000020449 ENSGACP00000020449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]