SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020693 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020693
Domain Number 1 Region: 114-305
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-34
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 2 Region: 6-75,106-146
Classification Level Classification E-value
Superfamily EF-hand 0.000000977
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020693   Gene: ENSGACG00000015680   Transcript: ENSGACT00000020732
Sequence length 588
Comment pep:novel group:BROADS1:groupII:10115093:10121947:1 gene:ENSGACG00000015680 transcript:ENSGACT00000020732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLREELLKSIWHAFTALDVDHRGKVSKSQLKVLSHSLCTVMKIPHDPVALEEHFKDDNK
GPLSNQGYMPYLNKFILDKVHGEFDLVEFNKICWLLCYKKNICTKRLLFSEDKAFKVWCI
FNFLSEDKYPLVIVTEEIEYFLQRLSEAMGSGWSEEKFADYKLQLHTKNNCLTAWELIEL
LGMGYFSHGLNSQILSMGITEVFQELILDVLKQGYMMKKGHKRKNWTERWFVLRPNSLSY
YVCEDLLEKKGDIILDRTCCVESLPDKEGKKCLFIIKCMDKSFEISASDKKKKQEWLQAI
QTCIRLLRLGLSSPHREARLRRKELRQRQQAEEDDVSERMRQLQVVNENKQRQLEGMRRK
IDAAAAEAAMEDHRRKQTELELQDRHRLDLEREKMVRQQMEEQVAQKSCELDQYLQRVRE
LEDMYHRLEGALEDERQAKQDEEAMRRLQARLLEEEAAKRAELEQIHLQQQRALSQTEAE
KQELVAEQRAKERDLQAAMLQLETLERERHGALEQYEKMSMKLERATNKTKTWKDKVAKH
EGLVRLIQPGHKGPQRITNWGPASFTDAELELRKKSWQESKNQGAAAQ
Download sequence
Identical sequences G3PSV7
ENSGACP00000020693 ENSGACP00000020693 69293.ENSGACP00000020693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]