SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021645 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021645
Domain Number 1 Region: 378-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-47
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 2 Region: 207-302
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-24
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 123-223
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-19
Family PDZ domain 0.00098
Further Details:      
 
Domain Number 4 Region: 71-123
Classification Level Classification E-value
Superfamily L27 domain 0.00000000106
Family L27 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021645   Gene: ENSGACG00000016393   Transcript: ENSGACT00000021686
Sequence length 586
Comment pep:novel group:BROADS1:groupIII:10283986:10298923:1 gene:ENSGACG00000016393 transcript:ENSGACT00000021686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPELITSTCGRPAGVCRLISSVMSGTESHTDREEDYRFLHSMLMEKKLHLLFKIHERLRR
FEKRGPVPVQDHAAGLASDLAEELICQCGRDRVKELAALLSKPNFKSLLSVHDAVAQRDF
EPSLPPLSDDSLEDDQDSVKIVSLVKTKDPLGATIRRDRATGAIVVARIMRGGAADKSGL
IHEGDELKEVNGVSLEHMKPKEILPLLTGSQGEVTFKIVPASTTEEMSSNKKLFMRALFD
YDPNDDPAVPCKDAAVAFKRGDVLRVVSMEDDTWWQACRLGDGSTRAGLIPSQQLHERSP
TAWKEFFLMFLQRILGPSLSFPAGLRRSFRLGRKSGRDGEAARSKRWSAGLHPRSSIRPP
TYKEVIPYHRDPKDRHRLVVLSQGPGGVGVDELKRRLLISDPDLFGVTVPYTTRERSRLE
TEGVDYHFVSVHMFEEDILNHRFVEYGRYKGHYYGTSLDSVHRVMAEGKVCLLDVHPNKI
KHVYTSEFKPYVVFVRPPSIEELRITRRRAKFLSDEEDENSARIFTEEDFEDMINSAETI
ESQCGHLFDKEIVNGDVAVAFRELKVDLENLKEAKVQWIPAKWICS
Download sequence
Identical sequences G3PVK6
69293.ENSGACP00000021645 ENSGACP00000021645 ENSGACP00000021645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]