SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023263 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023263
Domain Number 1 Region: 625-818
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000427
Further Details:      
 
Domain Number 2 Region: 443-551
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-16
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 
Domain Number 3 Region: 10-89
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000018
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 4 Region: 261-295
Classification Level Classification E-value
Superfamily WW domain 0.0000000334
Family WW domain 0.0025
Further Details:      
 
Domain Number 5 Region: 362-392
Classification Level Classification E-value
Superfamily WW domain 0.0000209
Family WW domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023263   Gene: ENSGACG00000017604   Transcript: ENSGACT00000023309
Sequence length 820
Comment pep:novel group:BROADS1:groupIII:14841647:14863718:-1 gene:ENSGACG00000017604 transcript:ENSGACT00000023309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTVRGVMAELPIAPGEVYIEVEYDYEYEFKGRLVVIQQGECYMLVKKANEDWWQVKKEEG
TKSFYVPARYVREVRKALMPPPKPLQHQPTTLELAPHGPSTENLHRHESGSRRSPSAHTA
SSGHFSPPRQRRGSDLHQPHPPGSPTDHERPLPDVLGGAPQPPPKGGHGSLPLSRARSPD
LGRAPLDADAARHCDSAGEERRTNDSESGDELSSSSTEPPQAIGLSDEQTVSSRRSESPV
YANLQELKISGSHVPPFPSGSSLNVMGDWETFKDQSGRYFYYNRSTQERTWKPPRVKDTS
AGSSRGESQSAGESSEPPSSSSEDACFSACSSQSDSQYGSPPRGWSEEMDERGHTLYVSE
HTNEKWLKHVDEQGRSYYYSADGSRSEWELPKYNHSPPQPPGDALKSYSLDRKRVDPIVL
TKLRHSTYLPDANDKPSEKSSDLNVTKITEHGKKVRKNWASSWTVLRGSTLIFAKGQGGG
TSWFGGGQSLPEFTVDLRGGSVEWASKDKSSKKHVLEVKTRQGTELLIQSDNDSLINEWH
QKLQETISTHAWESDEAIEEDMPESPVAEKPPPQELRDSKKGRGVKISSSMDTSDNKKTR
HKLKKFLTRRPTLQAVRDKGYIQDQVFGCSLSSLCLRESGTVPTFVRMCIDHVENNALSV
DGLYRVSGNLAIIQKLRFVVNHDEKVNLNDEKWEDIHVTTGALKMYFRELPEPLFTYTFF
HDFVGAIKISDYKQRVQSIKDLVRQLPKPNHDTMQALFKHLRRVIEYGEENRMTTQSVAI
VFGPTLLRPETETWNIAVHMVYQNQIVELILLEYENIFCR
Download sequence
Identical sequences G3Q073
ENSGACP00000023263 69293.ENSGACP00000023263 ENSGACP00000023263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]