SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023291 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023291
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-22
Family Ras-binding domain, RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023291   Gene: ENSGACG00000017627   Transcript: ENSGACT00000023337
Sequence length 328
Comment pep:novel group:BROADS1:groupII:23035978:23039880:-1 gene:ENSGACG00000017627 transcript:ENSGACT00000023337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMELKVWVEGVVRVVCGLSLTTSCQDVVIALAKSLGRTGRYLLIVKLRGAERQLVAEDCP
LQHLSQLGQLAPEFHFVLRRTGPSRGDGASSGPCPPAHLKRTWTPSPRASPEPRASPVSF
PDPHSSTKEEVFRDAGPTVVREAELEDLERRLRQNEADLMLGLRWEEKFQAEVDREEDLQ
RGLQRLHALMEDHPHQLEELQAHSVQLEQEVQLEGHRLSSRADSRPPEEALRPLKQELRY
RWQQGEDLEAAFSGTQRDLQAAEQKLQGRREMIEELNKELRQCKLQQFILQTGAPPPRDP
RRPLPQQCWHHGAAEGLDVMKSSTAELK
Download sequence
Identical sequences G3Q0A1
ENSGACP00000023291 69293.ENSGACP00000023291 ENSGACP00000023291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]