SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000029 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000029
Domain Number 1 Region: 166-495
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.56e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000204
Further Details:      
 
Domain Number 2 Region: 497-630
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.44e-29
Family Ricin B-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000029   Gene: ENSCPOG00000000034   Transcript: ENSCPOT00000000034
Sequence length 633
Comment pep:known scaffold:cavPor3:scaffold_3:23200925:23227716:1 gene:ENSCPOG00000000034 transcript:ENSCPOT00000000034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLKRLVKLHIKRHYYNKFWKLGAAVFFFIIILILMQREVNVQFSREESRMERNLKNKN
KMFDLMLEAVNNIKDVMPKMQIGAPVRQLVDSGQRPCLPGYYTAAELKPVLDRPPQDSNA
PGASGKAFKTTNLSIEEKKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKR
CPPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDDYLHEKLEEYI
KQFSIVKIVRQKERKGLITARLLGAAVATAETLTFLDAHCECFYGWLEPLLARIADNYTA
VVSPDIASIDLNTFEFNKPSPYGTNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTP
TFAGGLFSISKEYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSK
SPHSFPKGTQVIARNQVRLAEVWMDEYKEIFYRRNTEAAKIVKQKTFGDLSKRFAIRKRL
QCKNFTWYLNTVYPEVYVPDLNPVISGYIKSVGQPLCLDVGENNQGGKPLILYTCHGLGG
NQYFEYSAQHEIRHSIQKELCLHATSDLLQLKACAYKGRNTIVTGEQVWEIQKDQLLYNP
FLKLCLSANGKHPSLVSCNPSDPLQKWIFNQND
Download sequence
Identical sequences H0UT13
ENSCPOP00000000029 10141.ENSCPOP00000000029 XP_003478713.1.53824 ENSCPOP00000000029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]