SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000034 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000034
Domain Number 1 Region: 705-1000
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.0000000000322
Further Details:      
 
Domain Number 2 Region: 333-516
Classification Level Classification E-value
Superfamily L domain-like 1.87e-44
Family L domain 0.000000162
Further Details:      
 
Domain Number 3 Region: 33-206
Classification Level Classification E-value
Superfamily L domain-like 7.09e-43
Family L domain 0.000000489
Further Details:      
 
Domain Number 4 Region: 502-633
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.44e-24
Family Growth factor receptor domain 0.000000122
Further Details:      
 
Domain Number 5 Region: 184-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.34e-19
Family Growth factor receptor domain 0.0000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000034   Gene: ENSCPOG00000000040   Transcript: ENSCPOT00000000040
Sequence length 1207
Comment pep:known scaffold:cavPor3:scaffold_66:8629893:8668474:-1 gene:ENSCPOG00000000040 transcript:ENSCPOT00000000040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRPEATAGSSILPYILTICPLCTSMESIPVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLVALNTVERIPLENLQIVRGNVLYENTYALA
VLSNYGTGLRELPLRSLQEILHGAVRFSNNPVLCSVDTIQWRDIVNNLFLSNMSLDWQSP
QSGCQKCDPSCPNGSCWGPGAENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGP
RESDCLVCRRFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTD
HGSCVRACSSDSYEIEEDGVRKCKKCPTSLSSVCNGIGIGEFKDTLSINATNIKHFRNCT
TISGDLHILPVAFRGDSFTRTQPLDPKELDILKTVKEITGFLLIQAWPENRTNLHAFENL
EIIRGRTKQHGQFSLAVVGLNLTSLGLRSLKEISDGDVIVSGNRHLCYANTIHWRKLFGT
AGQKTKIVNNRNERDCKADGHVCHPLCSSEGCWGPEAQDCVSCQNVSRGRECVARCNIFE
GEPREFVENSECIQCHPECLPQAMNVTCTGRGPDNCVQCAHHIDGPHCVKTCPAGVMGEN
NTLVWKYADAGRVCRLCHPNCTYGCTGPGLQGCAIEGTKVPSIATGIVGGLFLLVLLGLG
IGLLMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAF
GTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLT
STVQLVTQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAARNV
LVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVT
VWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRE
LIVEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDIVDADEYLIPQQSF
FSSPSTSRTPLLSSLSANSNNSTGACVPRNGPQNCPVRSDGFLQRYSSDPTGTLTEDNLD
DAFLPVPEYINQSFPKRPAGSVQNPIYHNQPLHPAPGRDPHYQNPHSHAVGNPEYLNTTQ
STGVSGSFDSPGPWTQQGNHQLSLDNPDYQQDFFPKEAKPNGIFKGPTAENTEYLRVAPP
SSEFIGA
Download sequence
Identical sequences ENSCPOP00000000034 ENSCPOP00000000034 10141.ENSCPOP00000000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]