SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000162 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000162
Domain Number 1 Region: 181-377
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-31
Family Pentraxin (pentaxin) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000162   Gene: ENSCPOG00000000187   Transcript: ENSCPOT00000000188
Sequence length 382
Comment pep:known scaffold:cavPor3:scaffold_8:54592432:54597779:1 gene:ENSCPOG00000000187 transcript:ENSCPOT00000000188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRVILLCALWSAASAENSDDYELMYVNMDNEIFDGTHPTEDPTPCDCSREHSEWDKLF
IMLENSQMRESMLLQATDDVLRGELQKLRAELGRLSGSLARPCALAPRRRPGLARTLEEL
LRESRDAGRRLARLESAGVQRPEEEAGRALGAVLEELRRTRADLRAVQGWAARRWLPAGC
ETAILFPMRSKKIFGSVHPVRPMKLESFSACIWVKATDTLNKTIVFSYGTKRNPYEIQLY
LSYQSIVFVVGGEENKLVADTVISLGKWTHLCSTWNSEKGRTSLWAHSELVATAVDMATN
HVVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDHVLSREEIKETGGAESCHI
RGNVVGWGVTEIQPHGGAQYVS
Download sequence
Identical sequences A0A286X869
XP_003476359.1.53824 10141.ENSCPOP00000000162 ENSCPOP00000000162 ENSCPOP00000000162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]