SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000264 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000264
Domain Number 1 Region: 9-115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.36e-16
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 114-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000264   Gene: ENSCPOG00000000302   Transcript: ENSCPOT00000000305
Sequence length 262
Comment pep:known scaffold:cavPor3:scaffold_1:75638411:75686533:1 gene:ENSCPOG00000000302 transcript:ENSCPOT00000000305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHPNVSQGCQGGCATCSDYNGCLSCKPRLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDI
NKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECISIVHCETSE
WSPWSPCMKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTSETRKCTVQRKKCQKGERG
KKGRERKRKKLNKEEGKEAIPDNKGLESSRETPDQRENKDKSQQKKRKVQQKPVSGAEVT
LAEGLTIVSQRTLPAQYRRRHL
Download sequence
Identical sequences ENSCPOP00000000264 ENSCPOP00000000264 10141.ENSCPOP00000000264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]