SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000520 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000520
Domain Number 1 Region: 1551-1795
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-53
Family Ankyrin repeat 0.000000966
Further Details:      
 
Domain Number 2 Region: 458-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000659
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 332-460
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000973
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 748-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 566-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 257-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000785
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 906-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000013
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 8 Region: 948-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000239
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 658-792
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000204
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 10 Region: 790-914
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 11 Region: 216-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family EGF-type module 0.038
Further Details:      
 
Domain Number 12 Region: 986-1028
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000456
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 1232-1264
Classification Level Classification E-value
Superfamily Notch domain 0.000000589
Family Notch domain 0.0026
Further Details:      
 
Domain Number 14 Region: 1023-1066
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000748
Family EGF-type module 0.011
Further Details:      
 
Domain Number 15 Region: 174-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1195-1226
Classification Level Classification E-value
Superfamily Notch domain 0.00000248
Family Notch domain 0.0056
Further Details:      
 
Domain Number 17 Region: 62-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 294-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000381
Family EGF-type module 0.013
Further Details:      
 
Domain Number 19 Region: 138-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000748
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 27-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000401
Family EGF-type module 0.039
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000000520
Domain Number - Region: 100-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1113-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1155-1183
Classification Level Classification E-value
Superfamily Notch domain 0.0107
Family Notch domain 0.0038
Further Details:      
 
Domain Number - Region: 1069-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0215
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 606-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0643
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000520   Gene: ENSCPOG00000000591   Transcript: ENSCPOT00000000596
Sequence length 1956
Comment pep:known scaffold:cavPor3:scaffold_15:40825004:40843794:1 gene:ENSCPOG00000000591 transcript:ENSCPOT00000000596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLPCFPLAMTRGLRCGGFPEPCANGGTCLSPPLGPGACRCAPGFLGEMCQF
PDPCQEAQLCQNGGSCQALRFFCTCPSGFTGKQCEAQLEDPCPPFFCSKKGRCHLQGPGR
PRCSCLPGWTGEQCQLRDFCSASLCTSGGECLTTYPQIQCRCPQDLEGHTCEHDVKECFL
DQGPCPEGASCHNVLGSFRCLCPAGQKGPHCALQKGPCPAGGCPNGGTCQLVPGADASFH
LCLCPPGFTGLDCEVNPDNCAKHHCQHGGTCQDGLGAYTCLCPDAWTGWDCSEDVDECEA
QAPARCRNGGTCQNSAGGFHCVCVSGWGGSGCEENLDDCIDATCAPGSTCIDRVGSFACL
CPPGRTGLLCHLEDMCLSQPCHREAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECQIAQ
QGPSPCEHGGSCLNTPGSFHCLCPPGYTGLRCETDHNECLSQPCHPGSTCLDLLATFHCL
CPPGLEGQLCEVETNECASAPCLNHANCQDQLNGFLCVCQPGYTGTWCEEDVDECVSSPC
TNGGHCQDQPGAFLCKCPAGFEGPRCETEVDECLSGPCPSGASCLDLPGAFSCLCPAGFT
GPLCEVPLCAPNLCQPEQQCQEPDHGVHCLCPDGSPGCAPAGDNCTCHHGRCHRSACVCD
VGWTGPECEAELGGCVSAPCAHGGTCHPQPSGYNCTCPAGYTGPTCHEEVTACYSEPCLN
GGSCSPHPRGYSCTCPPSHTGPQCQTSADHCASAPCLHGGTCVDRPSTFSCVCAAGFQGL
RCERKAEPSCADSPCRNRATCQDNPQGPRCLCPSGYTGSSCQTLVDPCAQEPCPPTSRCL
QNGASFQCLCLQGWTGPLCGIPLSACQKAALSQGVEVSALCQNGGLCMDNGASHFCHCPP
GFQGSWCQHRANPCESGPCHNGATCVAQTGGYHCQCTPGYSGENCSEELSACQSQPCHNH
GTCTPRSGGFHCTCPAGFVGPRCEGDVDECLDRPCHPTGTAACRSLANAFHCDCLPGHTG
QRCEVQIDPCQSQPCSHGGSCQATAGPAPGFTCSCPKGFEGPTCSHRAPSCGPHHCHHGG
LCLPSPKPASPPRCACLDGFGDPDCLTPPASQGCGPPNPCLHNGSCSETPALGGPGFRCS
CPPDSPGPRCQKPGAKGCEGRGGDGACDAGCSGPSGAWDGGDCALGVPDPWKGCPRHSQC
WLLFRDGQCHPQCNSEECLFDGYDCEPPPTCNPAYDQYCRDHFNNGHCEKGCDTAECGWD
GGDCRPEQGASAWGPSLALLVVLRAPALDQQLLHLARVLSLTLRVGLWVKKDPEGRDMVF
PYPGAQAEAVLRGSGEPSPQESTAPHLQPPGQDTDSFGSGFVVVMGMDLSRCGPDQPTSR
CPWDPGLLFRFLAATVAVGALEPLLPGALLAVHPSTGTAPPTRQLPWLVLCSPVVGVLLL
ALGALLVLQLIRRRRRREHGALWLPPGFIRKPRTQQAPHRRRPPLGEDSIGLKALKPEAE
VEEDGVVMCTGPEEGEEAEETAPPPKCQLWPLNSRCGEIPQVAMLTPPQEASDVDTFGPD
GVTPLMSAVCCGGVESRTFQEAWLRSPEHWELLLDGGVCPQPHTVGTQETPLHLAARFSR
PTAARRLLEAGANPNAPDQAGRTPLHTAVAADAREVCQLLLSSRLTAVDARSEDGTTPLI
LAARLAVEDLVEELIAARADVGARDKWGKTALHWAAAVNNTRAARSLLQAGADKDAQDSK
EQTPLFLAAREGAVEVAQLLLGLGAARGLRDHAGLAPRDIARQRNHWDLLTLLEGVGPAE
ARHKAAPGREAGALVLPRSRTLSVGARPRGFRACAHARTSSGDVAARRGGAYARCRSPSG
AGALGGRRWSADSRAPRSGHEATRGRPRPPAGLGDLASAADQPCDWVTLGACCPTASSPM
PPLCLTPSPERGSPHVAWGLPVHQVMPLNPGLDGQK
Download sequence
Identical sequences ENSCPOP00000000520 10141.ENSCPOP00000000520 ENSCPOP00000000520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]