SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000000641 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000000641
Domain Number 1 Region: 1452-1558
Classification Level Classification E-value
Superfamily C-type lectin-like 8.24e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000383
Further Details:      
 
Domain Number 2 Region: 1559-1673
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-39
Family Noncollagenous (NC1) domain of collagen IV 0.00000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000000641   Gene: ENSCPOG00000000720   Transcript: ENSCPOT00000000725
Sequence length 1675
Comment pep:known scaffold:cavPor3:scaffold_13:33122469:33227835:1 gene:ENSCPOG00000000720 transcript:ENSCPOT00000000725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSSRRTKPLGKDPWSFVLLLFSIQHVYGSGKKYISPCGGRDCSVCQCFPEKGSRGQPG
PLGPQGPIGPLGPPGPIGIPGEKGLRGDRGPPGAAGEKGDKGPTGVPGFPGLDGIPGYPG
PPGSRGKPGVNGYNGSRGDPGFPGERGPSGPRGLPGKPVFSSKLAISVFISGGIKGIRGD
RGDPGAPGLPGARGAQGPEGPMGEPGAPGLTGPQGHPGSPGLKGNPGVGVKGQRGDPGEV
GQQGFPGPTLLVEPPDFCLYKGDKGIKGIPGMIGSPGPPGLKGAAGIGVKGEKGIPGFPG
PRGYPGSFGSPGFPGLKGEQGLVGDPGLFGFLGPKGDPGDRGYPGPPGVLVTPSPPLKGP
PGDPGFPGRHGEMGDIGPPGPPGPSGRPGEACPGMVGPPGPAGPPGPPGFPGAVGTPGRP
DFAPGRPGQPGPPGLPGAPGLQGPPGPDVICCSVGLPGPQGIKGKVGPPGVRGSKGEKGK
EGVCACAPGPMGPPGPPGLPGRPGDKGNAGLPGWVGEKGDPGPPGAEGSPGQPGQSGLPG
PPGNKGAKGDMVVSRVKGYKGERGPDGPPGLSGQPGENGQDGRAGEKGEPGPPGDHEDAA
PGEKGFPGPPGPPGKAGPVGPPGLGFPGPPGKRGQPGIPGRPGMRGPDGLKGSKGDTISC
NVTYPGRPGPPGFDGPPGPKGFPGPRGAPGLRCLDGQRSRVGPTLVLNFSVVKTGFRGDM
GDPGFRGEDGSSPLGPPGPPGSRGVSGQKGIPGDPAFGYPGPPGNRGPPGVPGIKGPRGD
PGCPGPEGAAGIPGLSGLQGPKGREGSAGFPGIPGSPGYSCRRGAPGIPGQPGAPGAPGS
PGSGPGRKGQQGDVGSPGPAGMKGLPGPPGLPGVDGLPGSSGIPGPFGVDGLPGHPGPKG
PQGPLGLPGFPGERGKPGPEGRLGRKGEIGEKGWPGFQGHPGARGAKGDRGPSGDEGEMA
IISERGENGETGPPGDSGFIGERGDRGAPGPPGRRGEPGRYGPPGFQRGEPGRNGQRGLP
GPPGPPGSPGLRGIIGFPGFPGDQGEPGSPGPPGVSGTDGTKGPKGIKGDAASEFGPPGP
KGEPGSPGCPGHFGVPGEQGLPGAQGLQGPPGWPGLPGYIGPPGCPGDQGMPGPRGHPGE
TGDPGPSGLPGDRGLPGAPGMKGPAGSPGLDGLHGLKGEKGAKGASGLHEMGPPGPMGLP
GLKGEMGDPGSPGISLPGPFGERGFPGPPGRPGPPGPAGAPGRVPKGDIPDPGPPGDQGH
PGPDGPQGAPGPPGTRGSVTLLKGEPGDCGLPGPRCQGVPGCDGKDGQKGPMGFPGPQGP
PGLPGAPGEKGLPGSPGRKGPTGPPGPRGEPGPPADVDACPRIPGLPGAPGPRGPEGAMG
PPGEQGPPGPGCKGEPGLDGRRGEDGIPGSPGPPGHKGDSGESGCPGAPGPPGPTGDPGP
KGHGLGYLSGFLLVVHSQTDEEPACPTGMPRLWSGYSLLYLEGQEKAHNQDLGLAGSCLP
VFSTLPFAYCNIHQVCHYARRNDKSYWLASAAPLPAMPLSEEEIRPYVSRCAVCEAPAQA
VAVHSQDRSIPPCPAAWRGLWIGYSFLMHTGAGAQGGGQALTSPGSCLQDFRAAPFLECQ
GRQGTCHFFANEYSFWLTTVKSDTQFSSGPSPDILKDGHAQRQKISRCQVCVKHS
Download sequence
Identical sequences ENSCPOP00000000641 10141.ENSCPOP00000000641 ENSCPOP00000000641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]